Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.3e-03

Expression

Synonym

Accession Q9BTD1
Symbols C11orf76

 Compartment GO Term (0)

AA Sequence

MAQLPSAQMPAPRTQPDLILVHPVLALSGRAPSILCSVPWDACELLATAMWWKTRILWGVFLISRTRPPA      1 - 70
PMQILILTLDPSEGEVCCKKRKPGQTGRNRVRMTTATCKPGGEASGETSPGTP                      71 - 123
//

Text Mined References (2)

PMID Year Title