Property Summary

NCBI Gene PubMed Count 36
PubMed Score 24.51
PubTator Score 20.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma -1.016 9.0e-06
adult high grade glioma -1.200 6.3e-04
atypical teratoid / rhabdoid tumor 1.900 1.1e-08
ependymoma 1.100 4.2e-08
glioblastoma 1.300 1.4e-03
group 3 medulloblastoma 1.100 5.5e-03
lung adenocarcinoma 1.300 8.0e-12
medulloblastoma, large-cell 1.200 1.8e-03
non-small cell lung cancer 1.431 3.1e-30
osteosarcoma 1.216 2.4e-03
primitive neuroectodermal tumor 1.300 5.3e-03
subependymal giant cell astrocytoma -1.084 3.7e-02

Gene RIF (21)

AA Sequence

MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKEIEEES      1 - 70
ETTVEADLTDKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSL     71 - 140
KTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARAL    141 - 210
DCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHSYDLSSAISVLVPLGGPVLCRDEMEEWSASEASLFE    211 - 280
EALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQI    281 - 350
STSNGKPGAVNGAVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCAICWLYWKKYGGLKMPT    351 - 420
QSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFARQVCKNTLRLR    421 - 490
QAARRPFVAINYAAIRAEYADRHAELSGSPLKSKSTRKPLACIIGYLEIHPAKKPNVIRSTPSLQTPTTK    491 - 560
RMLTTPNHTSLSILGKRNYSHHNGLDELTCCVSD                                        561 - 594
//

Text Mined References (39)

PMID Year Title