Property Summary

NCBI Gene PubMed Count 31
Grant Count 21
R01 Count 16
Funding $2,464,529.53
PubMed Score 20.11
PubTator Score 20.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 1.216 0.002
ependymoma 1.100 0.000
atypical teratoid / rhabdoid tumor 1.900 0.000
glioblastoma 1.300 0.001
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor 1.300 0.005
adrenocortical carcinoma -1.016 0.000
non-small cell lung cancer 1.431 0.000
adult high grade glioma -1.200 0.001
subependymal giant cell astrocytoma -1.084 0.037
lung adenocarcinoma 1.300 0.000

Protein-protein Interaction (8)

Gene RIF (16)

PMID Text
26483332 MTA3 suppress apoptosis of A549 an H157 cells by inhibiting BAX, PARP expression.
26198267 role in terminal trophoblast differentiation
25319202 This review focuses on the current knowledge about the function and regulation of MTA1 and MTA3 proteins in gynecological cancer, including ovarian, endometrial, and cervical tumors.
24293376 Using western blotting and luciferase assays, MTA3 was identified as a target of miR-495
24107548 MAT3 over-expression in non-small cell lung carcinoma and MAT3 mRNA level is a risk factor for lymph node metastasis and survival.
23671646 MTA3 expression is an independent prognostic factor in patients with gastroesophageal junction adenocarcinoma.
23510993 Down-regulation of MTA3 and up-regulation of CGB5 and Snail are associated with preeclampsia.
20865667 MTA3 is not a useful marker to assess and identify high-risk patients with endometrial adenocarcinomas
19363681 the high expression level of MTA proteins in human chorionic cells might facilitate trophoblast cell migration and neoangiogenesis
17050676 These findings identify MTA3 as an upstream physiologic repressor of Wnt4 in mammary epithelial cells.
More...

AA Sequence

MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKEIEEES      1 - 70
ETTVEADLTDKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSL     71 - 140
KTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARAL    141 - 210
DCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHSYDLSSAISVLVPLGGPVLCRDEMEEWSASEASLFE    211 - 280
EALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQI    281 - 350
STSNGKPGAVNGAVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCAICWLYWKKYGGLKMPT    351 - 420
QSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFARQVCKNTLRLR    421 - 490
QAARRPFVAINYAAIRAEYADRHAELSGSPLKSKSTRKPLACIIGYLEIHPAKKPNVIRSTPSLQTPTTK    491 - 560
RMLTTPNHTSLSILGKRNYSHHNGLDELTCCVSD                                        561 - 594
//

Publication (34)

PMID Year Title
26869315 2016 Structure, expression and functions of MTA genes.
26483332 2015 [Regulation Mechanism of MTA3 in the Apoptosis of NSCLC Cells].
26198267 2015 MTA3 regulates differentiation of human cytotrophoblast stem cells.
26028330 2015 Dysfunction of the Reciprocal Feedback Loop between GATA3- and ZEB2-Nucleated Repression Programs Contributes to Breast Cancer Metastasis.
25319202 2014 Function and regulation of MTA1 and MTA3 in malignancies of the female reproductive system.
25315816 2014 Identification and characterization of metastasis-associated gene/protein 1 (MTA1).
24293376 2014 MiR-495 regulates proliferation and migration in NSCLC by targeting MTA3.
24107548 2013 Analysis of MAT3 gene expression in NSCLC.
23671646 2013 The metastasis-associated gene MTA3, a component of the Mi-2/NuRD transcriptional repression complex, predicts prognosis of gastroesophageal junction adenocarcinoma.
23510993 2013 MTA3 regulates CGB5 and Snail genes in trophoblast.
More...