Property Summary

NCBI Gene PubMed Count 21
Grant Count 12
R01 Count 5
Funding $2,622,140.66
PubMed Score 79.06
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.003
gastric cancer -1.100 0.010
pancreatic cancer -1.300 0.006
Multiple myeloma 1.579 0.001
astrocytic glioma -1.400 0.002
ependymoma -1.500 0.006
oligodendroglioma -1.400 0.000
psoriasis -3.900 0.000
glioblastoma multiforme -2.100 0.000
osteosarcoma -2.438 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.300 0.006
juvenile dermatomyositis 1.294 0.000
acute quadriplegic myopathy 1.074 0.000
primary pancreatic ductal adenocarcinoma 1.156 0.002
adult high grade glioma -1.800 0.000
pilocytic astrocytoma -1.200 0.000
sonic hedgehog group medulloblastoma -1.200 0.005
pancreatic carcinoma -1.300 0.006
subependymal giant cell astrocytoma -1.990 0.013
spina bifida -1.150 0.041
ovarian cancer -1.800 0.000
Down syndrome 1.200 0.009

Gene RIF (3)

PMID Text
26687599 Data show that WAC directly binds to GM130 and that this binding is required for autophagosome formation through interacting with GABARAP regulating its subcellular localization.
26264232 WAC loss-of-function mutations cause a recognisable syndrome characterised by dysmorphic features, developmental delay and hypotonia and recapitulate 10p11.23 microdeletion syndrome
22354037 The identification of SCOC and WAC as novel regulatory proteins with diverse functions in autophagy contributes towards a fuller understanding of autophagosome formation.

AA Sequence

MVMYARKQQRLSDGCHDRRGDSQPYQALKYSSKSHPSSGDHRHEKMRDAGDPSPPNKMLRRSDSPENKYS      1 - 70
DSTGHSKAKNVHTHRVRERDGGTSYSPQENSHNHSALHSSNSHSSNPSNNPSKTSDAPYDSADDWSEHIS     71 - 140
SSGKKYYYNCRTEVSQWEKPKEWLEREQRQKEANKMAVNSFPKDRDYRREVMQATATSGFASGMEDKHSS    141 - 210
DASSLLPQNILSQTSRHNDRDYRLPRAETHSSSTPVQHPIKPVVHPTATPSTVPSSPFTLQSDHQPKKSF    211 - 280
DANGASTLSKLPTPTSSVPAQKTERKESTSGDKPVSHSCTTPSTSSASGLNPTSAPPTSASAVPVSPVPQ    281 - 350
SPIPPLLQDPNLLRQLLPALQATLQLNNSNVDISKINEVLTAAVTQASLQSIIHKFLTAGPSAFNITSLI    351 - 420
SQAAQLSTQAQPSNQSPMSLTSDASSPRSYVSPRISTPQTNTVPIKPLISTPPVSSQPKVSTPVVKQGPV    421 - 490
SQSATQQPVTADKQQGHEPVSPRSLQRSSSQRSPSPGPNHTSNSSNASNATVVPQNSSARSTCSLTPALA    491 - 560
AHFSENLIKHVQGWPADHAEKQASRLREEAHNMGTIHMSEICTELKNLRSLVRVCEIQATLREQRILFLR    561 - 630
QQIKELEKLKNQNSFMV                                                         631 - 647
//

Publication (32)

PMID Year Title
26687599 2015 Activation of ULK Kinase and Autophagy by GABARAP Trafficking from the Centrosome Is Regulated by WAC and GM130.
26264232 2015 WAC loss-of-function mutations cause a recognisable syndrome characterised by dysmorphic features, developmental delay and hypotonia and recapitulate 10p11.23 microdeletion syndrome.
25416956 2014 A proteome-scale map of the human interactome network.
25356899 2014 De novo mutations in moderate or severe intellectual disability.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22354037 2012 Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21329877 2011 WAC, a functional partner of RNF20/40, regulates histone H2B ubiquitination and gene transcription.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...