Property Summary

NCBI Gene PubMed Count 24
PubMed Score 84.93
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 1.074 9.3e-06
adult high grade glioma -1.100 6.4e-04
astrocytic glioma -1.400 2.4e-03
Astrocytoma, Pilocytic -1.200 1.2e-04
atypical teratoid / rhabdoid tumor -1.500 4.1e-04
Down syndrome 1.200 8.6e-03
ependymoma -1.500 6.0e-03
gastric cancer -1.100 9.8e-03
glioblastoma -1.800 6.3e-09
juvenile dermatomyositis 1.294 9.7e-15
medulloblastoma, large-cell -1.300 5.9e-03
Multiple myeloma 1.579 7.4e-04
oligodendroglioma -1.200 9.6e-03
osteosarcoma -2.438 5.5e-09
ovarian cancer -1.200 2.1e-03
pancreatic cancer -1.300 6.1e-03
pancreatic carcinoma -1.300 6.1e-03
primary pancreatic ductal adenocarcinoma 1.011 3.5e-02
psoriasis -3.900 3.1e-05
Rheumatoid arthritis 1.200 3.4e-03
sonic hedgehog group medulloblastoma -1.200 4.7e-03
spina bifida -1.150 4.1e-02
subependymal giant cell astrocytoma -1.990 1.3e-02

Protein-protein Interaction (3)

Gene RIF (5)

AA Sequence

MVMYARKQQRLSDGCHDRRGDSQPYQALKYSSKSHPSSGDHRHEKMRDAGDPSPPNKMLRRSDSPENKYS      1 - 70
DSTGHSKAKNVHTHRVRERDGGTSYSPQENSHNHSALHSSNSHSSNPSNNPSKTSDAPYDSADDWSEHIS     71 - 140
SSGKKYYYNCRTEVSQWEKPKEWLEREQRQKEANKMAVNSFPKDRDYRREVMQATATSGFASGMEDKHSS    141 - 210
DASSLLPQNILSQTSRHNDRDYRLPRAETHSSSTPVQHPIKPVVHPTATPSTVPSSPFTLQSDHQPKKSF    211 - 280
DANGASTLSKLPTPTSSVPAQKTERKESTSGDKPVSHSCTTPSTSSASGLNPTSAPPTSASAVPVSPVPQ    281 - 350
SPIPPLLQDPNLLRQLLPALQATLQLNNSNVDISKINEVLTAAVTQASLQSIIHKFLTAGPSAFNITSLI    351 - 420
SQAAQLSTQAQPSNQSPMSLTSDASSPRSYVSPRISTPQTNTVPIKPLISTPPVSSQPKVSTPVVKQGPV    421 - 490
SQSATQQPVTADKQQGHEPVSPRSLQRSSSQRSPSPGPNHTSNSSNASNATVVPQNSSARSTCSLTPALA    491 - 560
AHFSENLIKHVQGWPADHAEKQASRLREEAHNMGTIHMSEICTELKNLRSLVRVCEIQATLREQRILFLR    561 - 630
QQIKELEKLKNQNSFMV                                                         631 - 647
//

Text Mined References (36)

PMID Year Title