Property Summary

NCBI Gene PubMed Count 21
Grant Count 144
R01 Count 86
Funding $17,435,734.14
PubMed Score 126.66
PubTator Score 13.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.083 0.001
ovarian cancer 1.100 0.004

Synonym

Accession Q9BT92 Q8NAG0 Protein TCHP
Symbols TpMs

Gene

Gene RIF (6)

PMID Text
26880200 Ndel1 acts as a novel upstream regulator of the trichoplein-Aurora A pathway to inhibit primary cilia assembly.
24403067 These findings underscore the complexity of PGC-1alpha-mediated mitochondrial homeostasis and establish mitostatin as a key regulator of tumor cell mitophagy and angiostasis.
21325031 Trichoplein controls microtubule anchoring at the centrosome by binding to Odf2 and ninein.
20930847 Trichoplein/mitostatin is a new regulator of mitochondria-endoplasmic reticulum juxtaposition.
18931701 MITOSTATIN was found within a 3.2-kb transcript for an approximately 62 kDa mitochondrial protein with tumor suppressor activity. It inhibits cell growth, is proapoptotic and downregulates Hsp27.
15731013 trichoplein is a keratin 8/18-binding protein that may be involved in the organization of the apical network of keratin filaments and desmosomes in simple epithelial cells

AA Sequence

MALPTLPSYWCSQQRLNQQLARQREQEARLRQQWEQNSRYFRMSDICSSKQAEWSSKTSYQRSMHAYQRE      1 - 70
KMKEEKRRSLEARREKLRQLMQEEQDLLARELEELRLSMNLQERRIREQHGKLKSAKEEQRKLIAEQLLY     71 - 140
EHWKKNNPKLREMELDLHQKHVVNSWEMQKEEKKQQEATAEQENKRYENEYERARREALERMKAEEERRQ    141 - 210
LEDKLQAEALLQQMEELKLKEVEATKLKKEQENLLKQRWELERLEEERKQMEAFRQKAELGRFLRHQYNA    211 - 280
QLSRRTQQIQEELEADRRILQALLEKEDESQRLHLARREQVMADVAWMKQAIEEQLQLERAREAELQMLL    281 - 350
REEAKEMWEKREAEWARERSARDRLMSEVLTGRQQQIQEKIEQNRRAQEESLKHREQLIRNLEEVRELAR    351 - 420
REKEESEKLKSARKQELEAQVAERRLQAWEADQQEEEEEEEARRVEQLSDALLQQEAETMAEQGYRPKPY    421 - 490
GHPKIAWN                                                                  491 - 498
//

Text Mined References (22)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26880200 2016 Ndel1 suppresses ciliogenesis in proliferating cells by regulating the trichoplein-Aurora A pathway.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25416956 2014 A proteome-scale map of the human interactome network.
25270598 2014 Ubiquitin-proteasome system controls ciliogenesis at the initial step of axoneme extension.
24403067 2014 Decorin induces mitophagy in breast carcinoma cells via peroxisome proliferator-activated receptor ? coactivator-1? (PGC-1?) and mitostatin.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21325031 2011 Trichoplein controls microtubule anchoring at the centrosome by binding to Odf2 and ninein.
20930847 2010 Trichoplein/mitostatin regulates endoplasmic reticulum-mitochondria juxtaposition.
More...