Property Summary

NCBI Gene PubMed Count 21
PubMed Score 142.96
PubTator Score 13.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7950 5.7e-04
ovarian cancer 8520 4.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 4.232 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.083 5.7e-04
ovarian cancer 1.100 4.1e-03

Gene RIF (6)

AA Sequence

MALPTLPSYWCSQQRLNQQLARQREQEARLRQQWEQNSRYFRMSDICSSKQAEWSSKTSYQRSMHAYQRE      1 - 70
KMKEEKRRSLEARREKLRQLMQEEQDLLARELEELRLSMNLQERRIREQHGKLKSAKEEQRKLIAEQLLY     71 - 140
EHWKKNNPKLREMELDLHQKHVVNSWEMQKEEKKQQEATAEQENKRYENEYERARREALERMKAEEERRQ    141 - 210
LEDKLQAEALLQQMEELKLKEVEATKLKKEQENLLKQRWELERLEEERKQMEAFRQKAELGRFLRHQYNA    211 - 280
QLSRRTQQIQEELEADRRILQALLEKEDESQRLHLARREQVMADVAWMKQAIEEQLQLERAREAELQMLL    281 - 350
REEAKEMWEKREAEWARERSARDRLMSEVLTGRQQQIQEKIEQNRRAQEESLKHREQLIRNLEEVRELAR    351 - 420
REKEESEKLKSARKQELEAQVAERRLQAWEADQQEEEEEEEARRVEQLSDALLQQEAETMAEQGYRPKPY    421 - 490
GHPKIAWN                                                                  491 - 498
//

Text Mined References (22)

PMID Year Title