Property Summary

NCBI Gene PubMed Count 21
Grant Count 11
R01 Count 5
Funding $1,702,080.9
PubMed Score 10.78
PubTator Score 10.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
24164654 The genetic variations of VAMP2, Synaptotagmin XI might be indication of the relationship between these genes and idiopathic generalized epilepsy
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17192956 Excessive expression of Syt11 can be associated with schizophrenia.
15354386 Lack of disease-causing mutations in a detailed analysis of a large sample of familial and sporadic Parkinson's disease patients argues against a major role of mutations in the synaptotagmin XI gene in PD.
12925569 parkin interacts with and ubiquitinates synaptotagmin XI

AA Sequence

MAEITNIRPSFDVSPVVAGLIGASVLVVCVSVTVFVWSCCHQQAEKKQKNPPYKFIHMLKGISIYPETLS      1 - 70
NKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLT     71 - 140
PGESKTTSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRV    141 - 210
KTRVLRKTLDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRD    211 - 280
IIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHV    281 - 350
KKCTLNPIFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTASGAEHWREVCESPRK    351 - 420
PVAKWHSLSEY                                                               421 - 431
//

Publication (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24164654 2014 Genetic variants of synaptic vesicle and presynaptic plasma membrane proteins in idiopathic generalized epilepsy.
22645275 2012 Identification of novel ATP13A2 interactors and their role in ?-synuclein misfolding and toxicity.
21563316 2012 Synaptic vesicle trafficking and Parkinson's disease.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21292315 2011 Imputation of sequence variants for identification of genetic risks for Parkinson's disease: a meta-analysis of genome-wide association studies.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19060904 2009 An empirical framework for binary interactome mapping.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...