Property Summary

NCBI Gene PubMed Count 31
PubMed Score 35.63
PubTator Score 32.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (24)

AA Sequence

MASLLGAYPWPEGLECPALDAELSDGQSPPAVPRPPGDKGSESRIRRPMNAFMVWAKDERKRLAVQNPDL      1 - 70
HNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHMQDYPNYKYRPRRKKQAKRLCKRVDPGFLLSSLSR     71 - 140
DQNALPEKRSGSRGALGEKEDRGEYSPGTALPSLRGCYHEGPAGGGGGGTPSSVDTYPYGLPTPPEMSPL    141 - 210
DVLEPEQTFFSSPCQEEHGHPRRIPHLPGHPYSPEYAPSPLHCSHPLGSLALGQSPGVSMMSPVPGCPPS    211 - 280
PAYYSPATYHPLHSNLQAHLGQLSPPPEHPGFDALDQLSQVELLGDMDRNEFDQYLNTPGHPDSATGAMA    281 - 350
LSGHVPVSQVTPTGPTETSLISVLADATATYYNSYSVS                                    351 - 388
//

Text Mined References (32)

PMID Year Title