Property Summary

NCBI Gene PubMed Count 26
Grant Count 23
R01 Count 10
Funding $900,711.25
PubMed Score 30.11
PubTator Score 32.78

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
26944317 the HMG-box is a key domain of SOX7 for negatively regulating the Wnt/beta-catenin signaling pathway when functioning as a tumor suppressor in a glioma.
25940713 The results provided unequivocal evidence for a novel tumor suppressor role of SOX7 in acute myeloid leukemia
25407488 Ectopic expression of miR-492 led to downregulation of SOX7 protein.
25297608 The expression of SOX7 correlates with tumor progression as a tumor suppressor, possibly through the Wnt/beta-catenin signaling pathway in ovarian cancers, suggesting that SOX7 may be a promising prognostic marker.
25073511 Low SOX7 expression is associated with hepatocellular carcinoma.
24816720 SOX7 plays an important inhibitory role in hepatocarcinogenesis, and might be a novel target for hepatocellular carcinoma therapy.
24788044 Decreased expression of Sox7 correlates with the upregulation of the Wnt/beta-catenin signaling pathway and the poor survival of gastric cancer patients.
24558429 miR-184 represents a potential onco-miR and plays an important role in HCC progression by suppressing SOX7 expression
24012678 SOX7 acts as a tumor suppressor in breast cancer.
23557216 SOX7 is a novel tumor suppressor gene silenced in the majority of NSCLC samples.
More...

AA Sequence

MASLLGAYPWPEGLECPALDAELSDGQSPPAVPRPPGDKGSESRIRRPMNAFMVWAKDERKRLAVQNPDL      1 - 70
HNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHMQDYPNYKYRPRRKKQAKRLCKRVDPGFLLSSLSR     71 - 140
DQNALPEKRSGSRGALGEKEDRGEYSPGTALPSLRGCYHEGPAGGGGGGTPSSVDTYPYGLPTPPEMSPL    141 - 210
DVLEPEQTFFSSPCQEEHGHPRRIPHLPGHPYSPEYAPSPLHCSHPLGSLALGQSPGVSMMSPVPGCPPS    211 - 280
PAYYSPATYHPLHSNLQAHLGQLSPPPEHPGFDALDQLSQVELLGDMDRNEFDQYLNTPGHPDSATGAMA    281 - 350
LSGHVPVSQVTPTGPTETSLISVLADATATYYNSYSVS                                    351 - 388
//

Publication (27)

PMID Year Title
26944317 2016 SOX7 is associated with the suppression of human glioma by HMG-box dependent regulation of Wnt/?-catenin signaling.
25940713 2015 Suppression of SOX7 by DNA methylation and its tumor suppressor function in acute myeloid leukemia.
25416956 2014 A proteome-scale map of the human interactome network.
25407488 2015 MiR-492 contributes to cell proliferation and cell cycle of human breast cancer cells by suppressing SOX7 expression.
25297608 2014 Reduced expression of SOX7 in ovarian cancer: a novel tumor suppressor through the Wnt/?-catenin signaling pathway.
25073511 2014 miR-24 promotes the proliferation and invasion of HCC cells by targeting SOX7.
24816720 2014 The suppressive role of SOX7 in hepatocarcinogenesis.
24788044 2014 Decreased expression of Sox7 correlates with the upregulation of the Wnt/?-catenin signaling pathway and the poor survival of gastric cancer patients.
24558429 2014 Mir-184 post-transcriptionally regulates SOX7 expression and promotes cell proliferation in human hepatocellular carcinoma.
24012678 2013 The regulation of SOX7 and its tumor suppressive role in breast cancer.
More...