Property Summary

NCBI Gene PubMed Count 31
PubMed Score 6.31
PubTator Score 3.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.380 0.005
Multiple myeloma 1.402 0.004
colon cancer -1.700 0.039
diabetes mellitus -1.100 0.001
lung carcinoma 1.100 0.000
ovarian cancer -2.100 0.000

Synonym

Accession Q9BT78 B3KN88 B3KST5 Q561W7 Q9NW31 Q9Y677 SGN4
Symbols CSN4
SGN4

Gene

PDB

4D0P   4D10   4D18   4WSN  

Gene RIF (4)

PMID Text
24725084 CSN4 silencing decreases CSN5 protein levels and suggest that the CSN4 effects on sGCA1 and p53 proteins are mediated by CSN5.
22190034 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 4 (COPS4; CSN4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21102408 Identified is a novel-binding partner of torsin A, the subunit 4 (CSN4) of CSN signalosome.
11824616 Level in fetal Down syndrome brain found to be comparable to that of controls.

AA Sequence

MAAAVRQDLAQLMNSSGSHKDLAGKYRQILEKAIQLSGAEQLEALKAFVEAMVNENVSLVISRQLLTDFC      1 - 70
THLPNLPDSTAKEIYHFTLEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYN     71 - 140
VDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNE    141 - 210
LSYKTIVHESERLEALKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQE    211 - 280
FAAMLMPHQKATTADGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNG    281 - 350
FIDQIDGIVHFETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ                  351 - 406
//

Publication (36)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25416956 2014 A proteome-scale map of the human interactome network.
24725084 2014 COP9 subunits 4 and 5 target soluble guanylyl cyclase ?1 and p53 in prostate cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
21102408 2011 CSN complex controls the stability of selected synaptic proteins via a torsinA-dependent process.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
More...