Property Summary

NCBI Gene PubMed Count 33
PubMed Score 7.39
PubTator Score 3.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 2.3e-20
ovarian cancer 8520 9.1e-08
diabetes mellitus 1728 1.4e-03
Multiple myeloma 1332 3.9e-03
Waldenstrons macroglobulinemia 765 5.1e-03
colon cancer 1478 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (6)

Disease log2 FC p
colon cancer -1.700 3.9e-02
diabetes mellitus -1.100 1.4e-03
lung carcinoma 1.100 2.3e-20
Multiple myeloma 1.402 3.9e-03
ovarian cancer -2.100 9.1e-08
Waldenstrons macroglobulinemia 1.380 5.1e-03

Gene RIF (4)

AA Sequence

MAAAVRQDLAQLMNSSGSHKDLAGKYRQILEKAIQLSGAEQLEALKAFVEAMVNENVSLVISRQLLTDFC      1 - 70
THLPNLPDSTAKEIYHFTLEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYN     71 - 140
VDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNE    141 - 210
LSYKTIVHESERLEALKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQE    211 - 280
FAAMLMPHQKATTADGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNG    281 - 350
FIDQIDGIVHFETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ                  351 - 406
//

Text Mined References (39)

PMID Year Title