Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.77
PubTator Score 1.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.61347871252145E-37
lung adenocarcinoma 2714 4.58363721224235E-17
non-small cell lung cancer 2798 1.01603945368531E-13
lung carcinoma 2844 6.53122734137988E-13
ovarian cancer 8492 6.70821493913403E-11
interstitial cystitis 2299 0.0139452171926298
esophageal adenocarcinoma 737 0.0405253358497057
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 45 3.576 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
esophageal adenocarcinoma -1.700 0.041
non-small cell lung cancer -2.478 0.000
interstitial cystitis -2.800 0.014
lung adenocarcinoma -1.680 0.000
lung carcinoma -1.300 0.000
ovarian cancer -4.400 0.000
psoriasis -1.700 0.000

Synonym

Accession Q9BT76 A6NHH5 A8K231 A8MZA8 B3KPU5 Q75MM5 Q86W06 UP3b
Symbols P35
UP3B
UPIIIB

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
21984916 LRRN4 was only detected in primary mesothelial cells, but MSLN and UPK3B were also detected in other cell types.

AA Sequence

MGLPWGQPHLGLQMLLLALNCLRPSLSLGEWGSWMDASSQTQGAGGPAGVIGPWAPAPLRLGEAAPGTPT      1 - 70
PVSVAHLLSPVATELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVAFSNASRGFQN     71 - 140
PETLADIPASPQLLTDGHYMTLPLSPDQLPCGDPMAGSGGAPVLRVGHDHGCHQQPFCNAPLPGPGPYRE    141 - 210
DPRIHRHLARAAKWQHDRHYLHPLFSGRPPTLGLLGSLYHALLQPVVAGGGPGAAADRLLHGQALHDPPH    211 - 280
PTQRGRHTAGGLQAWPGPPPQPQPLAWPLCMGLGEMGRWE                                  281 - 320
//

Text Mined References (11)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21984916 2011 LRRN4 and UPK3B are markers of primary mesothelial cells.
18776082 2008 Regulation of the divalent metal ion transporter DMT1 and iron homeostasis by a ubiquitin-dependent mechanism involving Ndfips and WWP2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16814572 2006 Origin of the tetraspanin uroplakins and their co-evolution with associated proteins: implications for uroplakin structure and function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...