Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
esophageal adenocarcinoma -1.700 4.1e-02
interstitial cystitis -2.800 1.4e-02
lung adenocarcinoma -1.100 1.1e-16
lung carcinoma -1.300 6.5e-13
non-small cell lung cancer -2.478 1.0e-13
ovarian cancer -4.400 6.7e-11
psoriasis -1.700 2.6e-37

Gene RIF (1)

AA Sequence

MGLPWGQPHLGLQMLLLALNCLRPSLSLGEWGSWMDASSQTQGAGGPAGVIGPWAPAPLRLGEAAPGTPT      1 - 70
PVSVAHLLSPVATELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVAFSNASRGFQN     71 - 140
PETLADIPASPQLLTDGHYMTLPLSPDQLPCGDPMAGSGGAPVLRVGHDHGCHQQPFCNAPLPGPGPYRE    141 - 210
DPRIHRHLARAAKWQHDRHYLHPLFSGRPPTLGLLGSLYHALLQPVVAGGGPGAAADRLLHGQALHDPPH    211 - 280
PTQRGRHTAGGLQAWPGPPPQPQPLAWPLCMGLGEMGRWE                                  281 - 320
//

Text Mined References (13)

PMID Year Title