Property Summary

NCBI Gene PubMed Count 8
Grant Count 9
Funding $1,003,252
PubMed Score 28.98
PubTator Score 13.52

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
17189198 we report the identification of a chaperone, designated PAC3, as a component of alpha rings. PAC3 dissociates before the formation of half-proteasomes, a process coupled with the recruitment of beta subunits and hUmp1.[PAC3]

AA Sequence

MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQ      1 - 70
DEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW                       71 - 122
//

Publication (12)

PMID Year Title
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18278057 2008 Crystal structure of a chaperone complex that contributes to the assembly of yeast 20S proteasomes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17189198 2006 Cooperation of multiple chaperones required for the assembly of mammalian 20S proteasomes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12853948 2003 The DNA sequence of human chromosome 7.
More...