Property Summary

Ligand Count 1
NCBI Gene PubMed Count 8
PubMed Score 31.18
PubTator Score 13.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (1)

AA Sequence

MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQ      1 - 70
DEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW                       71 - 122
//

Text Mined References (12)

PMID Year Title