Property Summary

NCBI Gene PubMed Count 24
Grant Count 14
R01 Count 6
Funding $778,029.43
PubMed Score 22.04
PubTator Score 10.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.400 0.001
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.600 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -2.100 0.000
pancreatic ductal adenocarcinoma liver m... -2.153 0.008
non-small cell lung cancer -1.183 0.000
pediatric high grade glioma -1.200 0.000
non primary Sjogren syndrome sicca 1.200 0.018
Alzheimer's disease -1.200 0.043
Pick disease -1.600 0.000
invasive ductal carcinoma -1.200 0.006
ovarian cancer -2.700 0.000

 GO Function (1)

Pathway (1)

Gene RIF (11)

PMID Text
26363003 Data show that membrane protein Ndfip1 recruits E3 ubiquitin (Ub) ligase Nedd4-2 to the Golgi to target ether-a-go-go-related gene (hERG) channel for degradation while membrane protein Ndfip2 also mediates Nedd4-2 interaction with hERG in the Golgi.
26319551 Silencing of Ndfip1 inhibited cytokine-induced apoptosis of pancreatic islets and promoted glucose-stimulated insulin secretion. These effects were associated with an increase in the cellular content of JunB, a potent inhibitor of ER stress and apoptosis.
25631046 Ndfip1 is required during stress for ubiquitinating and trafficking BRAT1 into the nucleus.
24475238 In Parkinson's disease, increased iron levels are associated with increased Ndfip1 expression for the regulation of DMT1, including abnormal Ndfip1 activation in non-neuronal cell types such as astrocytes.
23087404 Ndfip1 negatively regulates RIG-I-dependent immune signaling by enhancing E3 ligase Smurf1-mediated MAVS degradation.
21187286 Cellular up-regulation of Nedd4 family interacting protein 1 (Ndfip1) using low levels of bioactive cobalt complexes.
20534535 PTEN/Akt and MAP kinase signaling pathways are regulated by the ubiquitin ligase activators Ndfip1 and Ndfip2
19706893 Ndfip1 plays a critical role in regulating metal transport in human neurons through its regulation of DMT1.
19343052 Data show that the small PY-containing membrane proteins, NDFIP1 and NDFIP2 (NEDD4 family-interacting proteins), activate the catalytic activity of ITCH and of several other HECT ligases by binding to them.
18854154 Knockdown of Nedd4 family interacting protein 1 (NDFIP1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
More...

AA Sequence

MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVA      1 - 70
TTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLT     71 - 140
TSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFS    141 - 210
NLPRTRVLFIY                                                               211 - 221
//

Publication (26)

PMID Year Title
26363003 2015 Regulation of the human ether-a-go-go-related gene (hERG) potassium channel by Nedd4 family interacting proteins (Ndfips).
26319551 2015 Nedd4 family interacting protein 1 (Ndfip1) promotes death of pancreatic beta cells.
25631046 2015 Nedd4 family interacting protein 1 (Ndfip1) is required for ubiquitination and nuclear trafficking of BRCA1-associated ATM activator 1 (BRAT1) during the DNA damage response.
24475238 2014 Increased Ndfip1 in the substantia nigra of Parkinsonian brains is associated with elevated iron levels.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23087404 2012 Ndfip1 negatively regulates RIG-I-dependent immune signaling by enhancing E3 ligase Smurf1-mediated MAVS degradation.
22561531 2012 Genome-wide association study to identify genetic determinants of severe asthma.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21187286 2011 Cellular up-regulation of Nedd4 family interacting protein 1 (Ndfip1) using low levels of bioactive cobalt complexes.
More...