Property Summary

NCBI Gene PubMed Count 25
PubMed Score 24.35
PubTator Score 10.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Alzheimer's disease -1.200 4.3e-02
atypical teratoid / rhabdoid tumor 1.100 2.2e-03
glioblastoma -1.600 3.2e-05
group 4 medulloblastoma 1.200 2.2e-02
invasive ductal carcinoma -1.200 5.8e-03
medulloblastoma, large-cell -2.100 1.3e-05
non primary Sjogren syndrome sicca 1.200 1.8e-02
non-small cell lung cancer -1.183 2.6e-21
ovarian cancer -1.800 1.2e-04
pancreatic ductal adenocarcinoma liver m... -2.153 7.8e-03
pediatric high grade glioma -1.200 1.1e-04
Pick disease -1.300 1.9e-03
psoriasis -1.300 4.2e-08

Gene RIF (12)

AA Sequence

MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVA      1 - 70
TTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLT     71 - 140
TSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFS    141 - 210
NLPRTRVLFIY                                                               211 - 221
//

Text Mined References (29)

PMID Year Title