Property Summary

NCBI Gene PubMed Count 14
PubMed Score 637.94
PubTator Score 27.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Gene RIF (6)

AA Sequence

MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPE      1 - 70
RRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW                             71 - 116
//

Text Mined References (15)

PMID Year Title