Property Summary

NCBI Gene PubMed Count 12
PubMed Score 568.07
PubTator Score 27.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 3.44368274856641E-19
atypical teratoid/rhabdoid tumor 1095 1.30634177185908E-16
malignant mesothelioma 3163 1.18386036819603E-7
pediatric high grade glioma 2712 1.08664862356213E-6
pilocytic astrocytoma 3086 1.12900793269344E-6
group 4 medulloblastoma 1875 1.2186581398733E-6
ovarian cancer 8492 1.72765281418168E-6
juvenile dermatomyositis 1189 7.37353531283318E-6
primary pancreatic ductal adenocarcinoma 1271 7.64202524087452E-6
breast carcinoma 1614 5.21866527912352E-5
pancreatic cancer 2300 6.6911823039963E-5
glioblastoma 5572 2.19735167635476E-4
pancreatic carcinoma 567 2.28674709168686E-4
primitive neuroectodermal tumor 3031 4.12807783986468E-4
osteosarcoma 7933 6.64871100694681E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.79554254391368E-4
Duchenne muscular dystrophy 602 0.00107124250993185
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00113324427584807
medulloblastoma, large-cell 6234 0.00156408811777483
pituitary cancer 1972 0.00176877970222522
oligodendroglioma 2849 0.00312766312115937
gastric cancer 436 0.00337726449902025
subependymal giant cell astrocytoma 2287 0.0050040052481748
invasive ductal carcinoma 2950 0.00558741401697705
ductal carcinoma in situ 1745 0.0064978205160844
Atopic dermatitis 944 0.0115514516159952
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0127272232802046
hepatocellular carcinoma 550 0.0322868937426749
ependymoma 2514 0.0352904664591862
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0462520386958342

Expression

Synonym

Accession Q9BT56 B3KND6
Symbols C12orf39

Gene

SPX

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Chicken OMA EggNOG

Gene RIF (4)

PMID Text
26211893 Circulating spexin levels are low in T2DM patients and negatively related to blood glucose and lipids suggesting that the peptide may play a role in glucose and lipid metabolism in T2DM.
24517231 Data from ligand-receptor interaction studies suggest that human spexin-1 and zebrafish spexin-2 activate galanin receptors GALR2/GALR3 (but not GALR1); thus spexins appear to be natural ligands for human/Xenopus/zebrafish GALR2/GALR3.
22038051 newly identified peptides derived from the NPQ/spexin precursor contribute to CNS-mediated control of arterial blood pressure and salt and water balance and modulate nociceptive responses
19193193 Taken together, although C12ORF39 is not a secreted small peptide, it can also be secreted to play a role in the biological functions of the placenta.

AA Sequence

MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPE      1 - 70
RRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW                             71 - 116
//

Text Mined References (13)

PMID Year Title
26211893 2015 Spexin peptide is expressed in human endocrine and epithelial tissues and reduced after glucose load in type 2 diabetes.
24550067 2014 Spexin is a novel human peptide that reduces adipocyte uptake of long chain fatty acids and causes weight loss in rodents with diet-induced obesity.
24517231 2014 Coevolution of the spexin/galanin/kisspeptin family: Spexin activates galanin receptor type II and III.
23080164 2012 Spexin is expressed in the carotid body and is upregulated by postnatal hyperoxia exposure.
22038051 2012 Peptides derived from the prohormone proNPQ/spexin are potent central modulators of cardiovascular and renal function and nociception.
19193193 2009 C12ORF39, a novel secreted protein with a typical amidation processing signal.
19132080 2009 Evolutionary sequence modeling for discovery of peptide hormones.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17284679 2007 Identification of novel peptide hormones in the human proteome by hidden Markov model screening.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
More...