Property Summary

NCBI Gene PubMed Count 12
Grant Count 24
R01 Count 18
Funding $5,409,286.25
PubMed Score 568.07
PubTator Score 27.07

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
26211893 Circulating spexin levels are low in T2DM patients and negatively related to blood glucose and lipids suggesting that the peptide may play a role in glucose and lipid metabolism in T2DM.
24517231 Data from ligand-receptor interaction studies suggest that human spexin-1 and zebrafish spexin-2 activate galanin receptors GALR2/GALR3 (but not GALR1); thus spexins appear to be natural ligands for human/Xenopus/zebrafish GALR2/GALR3.
22038051 newly identified peptides derived from the NPQ/spexin precursor contribute to CNS-mediated control of arterial blood pressure and salt and water balance and modulate nociceptive responses
19193193 Taken together, although C12ORF39 is not a secreted small peptide, it can also be secreted to play a role in the biological functions of the placenta.

AA Sequence

MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPE      1 - 70
RRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW                             71 - 116
//

Publication (13)

PMID Year Title
26211893 2015 Spexin peptide is expressed in human endocrine and epithelial tissues and reduced after glucose load in type 2 diabetes.
24550067 2014 Spexin is a novel human peptide that reduces adipocyte uptake of long chain fatty acids and causes weight loss in rodents with diet-induced obesity.
24517231 2014 Coevolution of the spexin/galanin/kisspeptin family: Spexin activates galanin receptor type II and III.
23080164 2012 Spexin is expressed in the carotid body and is upregulated by postnatal hyperoxia exposure.
22038051 2012 Peptides derived from the prohormone proNPQ/spexin are potent central modulators of cardiovascular and renal function and nociception.
19193193 2009 C12ORF39, a novel secreted protein with a typical amidation processing signal.
19132080 2009 Evolutionary sequence modeling for discovery of peptide hormones.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17284679 2007 Identification of novel peptide hormones in the human proteome by hidden Markov model screening.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
More...