Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.18
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 1.5e-06
Disease Target Count Z-score Confidence
Bladder exstrophy 32 5.911 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.700 1.5e-06

Gene RIF (2)

AA Sequence

MPRHCSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEYIYFCSKHFEE      1 - 70
DCFELVGISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPAEVSRLRRCRKRCSEGRGPTTPFSPP     71 - 140
PPADVTCFPVEEASAPATLPASPAGRLEPGLSSPFSDLLGPLGAQADEAGCSAQPSPERQPSPLEPRPVS    141 - 210
PSAYMLRLPPPAGAYIQNEHSYQVGSALLWKRRAEAALDALDKAQRQLQACKRREQRLRLRLTKLQQERA    211 - 280
REKRAQADARQTLKEHVQDFAMQLSSSMA                                             281 - 309
//

Text Mined References (19)

PMID Year Title