Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.18
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
malignant mesothelioma 3,162

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.700 0.000

Synonym

Accession Q9BT49 B2RD97 D3DX40
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
16195249 THAP7 may represent a novel class of transcription factor that uses TAF-Ibeta as a corepressor to maintain histones in a hypoacetylated, repressed state.
15561719 demonstration of the transcriptional regulatory properties of a human THAP domain protein, and a critical identification of a potential transducer of the repressive signal of hypoacetylated histone H4 in higher eukaryotes

AA Sequence

MPRHCSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEYIYFCSKHFEE      1 - 70
DCFELVGISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPAEVSRLRRCRKRCSEGRGPTTPFSPP     71 - 140
PPADVTCFPVEEASAPATLPASPAGRLEPGLSSPFSDLLGPLGAQADEAGCSAQPSPERQPSPLEPRPVS    141 - 210
PSAYMLRLPPPAGAYIQNEHSYQVGSALLWKRRAEAALDALDKAQRQLQACKRREQRLRLRLTKLQQERA    211 - 280
REKRAQADARQTLKEHVQDFAMQLSSSMA                                             281 - 309
//

Publication (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22593554 2012 Observation of dually decoded regions of the human genome using ribosome profiling data.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18585351 2008 Ronin is essential for embryogenesis and the pluripotency of mouse embryonic stem cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17577209 2007 The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...