Property Summary

NCBI Gene PubMed Count 6
Grant Count 2
Funding $839,458.2
PubMed Score 28.52

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MASRGGGRGRGRGQLTFNVEAVGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGA      1 - 70
MRQLPYFIRPAVPKRDVERYSDKYQMSGPIDNAIDWNPDWRRLPRELKIRVRKLQKERITILLPKRPPKT     71 - 140
TEDKEETIQKLETLEKKEEEVTSEEDEEKEEEEEKEEEEEEEYDEEEHEEETDYIMSYFDNGEDFGGDSD    141 - 210
DNMDEAIY                                                                  211 - 218
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24107381 2014 Gene duplication and neofunctionalization: POLR3G and POLR3GL.
21269460 2011 Initial characterization of the human central proteome.
20154270 2010 Two isoforms of human RNA polymerase III with specific functions in cell growth and transformation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.