Property Summary

NCBI Gene PubMed Count 21
PubMed Score 10.10
PubTator Score 33.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.400 3.1e-15
psoriasis 1.800 2.4e-04

 GWAS Trait (1)

Protein-protein Interaction (9)

Gene RIF (8)

AA Sequence

MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGIISLLSDAAFND      1 - 70
SWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYG     71 - 140
YYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHFVRESIK    141 - 210
NRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPC    211 - 280
AGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYS    281 - 350
STSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR    351 - 420
SVVGISRPFQIPPGSLREDPLGEAQPQI                                              421 - 448
//

Text Mined References (24)

PMID Year Title