Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.89
PubTator Score 33.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.200 0.000
lung adenocarcinoma -1.400 0.000

Synonym

Accession Q9BT40 B2R6I2 B2R750 D3DTH8 Q15733 Q9NPJ5 Q9P2R5
Symbols PPS
SKIP

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
25241900 Study reveals that SKIP is a significant regulator of glioblastoma cell migration and that increased expression of SKIP may confer a survival advantage.
22815484 SKIP controls the IGF-II-PI 3-kinase-Akt-mTOR auto-regulation loop during myogenesis.
22751929 Specific suppression of insulin signaling is achieved via the spatiotemporal regulation of SKIP through the scaffolding function of Pak1.
18774950 The authors report that HBV core protein interacts with a cellular SKIP (skeletal muscle and kidney enriched inositol phosphatase) protein, an endoplasmic reticulum-located phosphoinositide 5-phosphatase, both in vivo and in vitro.
12536145 identification of novel domain that mediates membrane ruffle localization

AA Sequence

MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGIISLLSDAAFND      1 - 70
SWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYG     71 - 140
YYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHFVRESIK    141 - 210
NRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPC    211 - 280
AGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYS    281 - 350
STSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR    351 - 420
SVVGISRPFQIPPGSLREDPLGEAQPQI                                              421 - 448
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25241900 2015 Differential SKIP expression in PTEN-deficient glioblastoma regulates cellular proliferation and migration.
22815484 2012 Role of phosphatidylinositol 3,4,5-trisphosphate (PIP3) 5-phosphatase skeletal muscle- and kidney-enriched inositol polyphosphate phosphatase (SKIP) in myoblast differentiation.
22751929 2012 Regulation of insulin signaling by the phosphatidylinositol 3,4,5-triphosphate phosphatase SKIP through the scaffolding function of Pak1.
21712384 2011 Silencer of death domains (SODD) inhibits skeletal muscle and kidney enriched inositol 5-phosphatase (SKIP) and regulates phosphoinositide 3-kinase (PI3K)/Akt signaling to the actin cytoskeleton.
19946888 2010 Defining the membrane proteome of NK cells.
18774950 2009 Suppression of hepatitis B viral gene expression by phosphoinositide 5-phosphatase SKIP.
18573875 2008 Increased insulin action in SKIP heterozygous knockout mice.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...