Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.72
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Neoplasm Recurrence, Local 37 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count P-value
osteosarcoma 7950 2.9e-08
malignant mesothelioma 3232 3.3e-08
cutaneous lupus erythematosus 1057 1.0e-02
Rheumatoid arthritis 1191 3.8e-02

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 1.0e-02
malignant mesothelioma 2.900 3.3e-08
osteosarcoma -3.002 2.9e-08
Rheumatoid arthritis -1.400 3.8e-02

AA Sequence

MFQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKTVYPMERLVADKLIFHNSCFCCKHC      1 - 70
HTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWAHKEVDPGTKTA                  71 - 127
//

Text Mined References (10)

PMID Year Title