Property Summary

NCBI Gene PubMed Count 19
PubMed Score 56.77
PubTator Score 42.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Congenital disorder of glycosylation type 1K 1 0.0 0.0
Disease Target Count P-value
intraductal papillary-mucinous adenoma (IPMA) 2955 4.1e-03
active Crohn's disease 922 6.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 54 4.911 2.5
Disease Target Count
ALG1-CDG 1

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease 1.200 6.3e-03
intraductal papillary-mucinous adenoma (... 1.100 4.1e-03

Gene RIF (6)

AA Sequence

MAASCLVLLALCLLLPLLLLGGWKRWRRGRAARHVVAVVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCN      1 - 70
SKPHDELLQNNRIQIVGLTELQSLAVGPRVFQYGVKVVLQAMYLLWKLMWREPGAYIFLQNPPGLPSIAV     71 - 140
CWFVGCLCGSKLVIDWHNYGYSIMGLVHGPNHPLVLLAKWYEKFFGRLSHLNLCVTNAMREDLADNWHIR    141 - 210
AVTVYDKPASFFKETPLDLQHRLFMKLGSMHSPFRARSEPEDPVTERSAFTERDAGSGLVTRLRERPALL    211 - 280
VSSTSWTEDEDFSILLAALEKFEQLTLDGHNLPSLVCVITGKGPLREYYSRLIHQKHFQHIQVCTPWLEA    281 - 350
EDYPLLLGSADLGVCLHTSSSGLDLPMKVVDMFGCCLPVCAVNFKCLHELVKHEENGLVFEDSEELAAQL    351 - 420
QMLFSNFPDPAGKLNQFRKNLRESQQLRWDESWVQTVLPLVMDT                              421 - 464
//

Text Mined References (23)

PMID Year Title