Property Summary

NCBI Gene PubMed Count 11
PubMed Score 648.76
PubTator Score 150.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.500 8.2e-04
astrocytic glioma 1.300 3.9e-03
atypical teratoid / rhabdoid tumor 1.100 5.1e-04
Breast cancer 3.200 2.8e-02
ependymoma 1.300 4.8e-03
glioblastoma 1.200 3.4e-04
group 3 medulloblastoma 1.600 1.2e-03
malignant mesothelioma -1.300 1.6e-06
medulloblastoma, large-cell 1.300 5.3e-05
Multiple myeloma 1.877 1.1e-03
oligodendroglioma 1.400 8.6e-03
ovarian cancer 3.000 1.8e-06
pancreatic cancer 1.200 9.0e-03
Pick disease 1.600 1.8e-06
primary pancreatic ductal adenocarcinoma 1.146 1.1e-02
primitive neuroectodermal tumor 1.800 2.8e-04
psoriasis 1.200 9.5e-04

Synonym

Accession Q9BSY9 B1APK6 Q5VVC6 Q9NYS2 Q9Y3E4 DeSI-2
Symbols DESI
DESI1
DeSI-2
PNAS-4
PPPDE1
CGI-146
FAM152A
C1orf121

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFK      1 - 70
EAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPF     71 - 140
LQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHTKL                    141 - 194
//

Text Mined References (13)

PMID Year Title