Property Summary

NCBI Gene PubMed Count 10
Grant Count 19
R01 Count 4
Funding $3,296,466.92
PubMed Score 582.19
PubTator Score 150.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Multiple myeloma 1.877 0.001
malignant mesothelioma -1.300 0.000
astrocytic glioma 1.300 0.004
ependymoma 1.300 0.005
oligodendroglioma 1.400 0.009
psoriasis 1.200 0.001
glioblastoma 2.100 0.000
atypical teratoid / rhabdoid tumor 2.300 0.000
medulloblastoma, large-cell 2.100 0.000
primitive neuroectodermal tumor 1.800 0.000
primary pancreatic ductal adenocarcinoma 1.146 0.011
Breast cancer 3.200 0.028
pediatric high grade glioma 1.600 0.000
group 3 medulloblastoma 1.600 0.001
Pick disease 1.600 0.000
ovarian cancer 3.000 0.000
pancreatic cancer 1.200 0.009

Gene RIF (5)

PMID Text
25918161 findings suggest a novel mechanism by which elevated PNAS-4 first causes DNA-dependent protein kinase-mediated Chk1/2 activation and then results in inhibition of the Cdc25A-CDK2-cyclin E/A pathway
25079376 DESI2 may influence the AKT/mTOR signal in pancreatic cancer.
23322088 hPNAS-4 inhibits proliferation of ovarian cancer cells by inducing S phase arrest and apoptosis via activation of Cdc25A-Cdk2-Cyclin E/Cyclin A axis and mitochondrial dysfunction-mediated caspase-dependent and -independent apoptotic pathways.
21556770 PNAS-4 is not a p53 target, but overexpression of PNAS-4 is correlated to p53 inactivity in colorectal cancer.
19133312 overexpression of human PNAS4 induced apoptosis and arrested cell cycle in S phase in A549 human lung adenocarcinoma cells.

AA Sequence

MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFK      1 - 70
EAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPF     71 - 140
LQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHTKL                    141 - 194
//

Publication (12)

PMID Year Title
25918161 2015 PNAS-4, an Early DNA Damage Response Gene, Induces S Phase Arrest and Apoptosis by Activating Checkpoint Kinases in Lung Cancer Cells.
25079376 2015 High Phosphorylation Status of AKT/mTOR Signal in DESI2-Reduced Pancreatic Ductal Adenocarcinoma.
23322088 2013 hPNAS-4 inhibits proliferation through S phase arrest and apoptosis: underlying action mechanism in ovarian cancer cells.
22370726 2012 DeSUMOylating isopeptidase: a second class of SUMO protease.
21556770 2012 PNAS-4 expression and its relationship to p53 in colorectal cancer.
21269460 2011 Initial characterization of the human central proteome.
19133312 2009 A novel pro-apoptosis gene PNAS4 that induces apoptosis in A549 human lung adenocarcinoma cells and inhibits tumor growth in mice.
18538138 2008 Pnas4 is a novel regulator for convergence and extension during vertebrate gastrulation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...