Property Summary

NCBI Gene PubMed Count 4
PubMed Score 11.07
PubTator Score 4.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.16499509536221E-8
glioblastoma 5572 6.85233113903419E-4
group 3 medulloblastoma 2254 0.00130008814734084
Disease Target Count Z-score Confidence
Vaginal discharge 7 4.367 2.2
Cellulitis 13 4.029 2.0
Gastroenteritis 46 3.048 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 1.400 0.000
glioblastoma 1.100 0.001
group 3 medulloblastoma 1.300 0.001

Synonym

Accession Q9BSY4 Q585T4 Q8N8C4
Symbols MIC14
C2orf9

Gene

PDB

2LQL  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus EggNOG Inparanoid

Gene RIF (1)

PMID Text
22842048 Molecular interactions guiding the protein recognition between Mia40 and the disulfide-reduced CHCHD5 and CHCHD7.

AA Sequence

MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLR      1 - 70
QNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS                                   71 - 110
//

Text Mined References (6)

PMID Year Title
22842048 2012 Structural characterization of CHCHD5 and CHCHD7: two atypical human twin CX9C proteins.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.