Property Summary

NCBI Gene PubMed Count 4
PubMed Score 11.07
PubTator Score 4.83

Knowledge Summary


No data available


  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 1.400 0.000
glioblastoma 1.100 0.001
group 3 medulloblastoma 1.300 0.001


Accession Q9BSY4 Q585T4 Q8N8C4
Symbols MIC14




Gene RIF (1)

22842048 Molecular interactions guiding the protein recognition between Mia40 and the disulfide-reduced CHCHD5 and CHCHD7.

AA Sequence

QNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS                                   71 - 110

Publication (6)

PMID Year Title
22842048 2012 Structural characterization of CHCHD5 and CHCHD7: two atypical human twin CX9C proteins.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.