Property Summary

NCBI Gene PubMed Count 4
PubMed Score 11.64
PubTator Score 4.83

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
ependymoma 4679 8.2e-07
glioblastoma 5792 6.9e-04
group 3 medulloblastoma 4104 1.3e-03
Disease Target Count Z-score Confidence
Vaginal discharge 9 4.028 2.0
Cellulitis 20 3.707 1.9


  Differential Expression (3)

Disease log2 FC p
ependymoma 1.200 8.2e-07
glioblastoma 1.100 6.9e-04
group 3 medulloblastoma 1.300 1.3e-03


Accession Q9BSY4 Q585T4 Q8N8C4
Symbols MIC14




  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

QNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS                                   71 - 110

Text Mined References (6)

PMID Year Title