Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.97
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.4963164146059E-50
lung carcinoma 2844 3.84500754022111E-21
medulloblastoma 1524 1.06725690387184E-6
malignant mesothelioma 3163 1.29231628694991E-5
interstitial cystitis 2299 1.9556038518178E-5
pituitary cancer 1972 3.10828611162642E-5
medulloblastoma, large-cell 6234 4.04376917832393E-4
chronic lymphocytic leukemia 244 0.00428212934690245
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00448333612106195
ovarian cancer 8492 0.00451468266306407
invasive ductal carcinoma 2950 0.00525914277623392
atypical teratoid / rhabdoid tumor 4369 0.00804220576649508
cutaneous lupus erythematosus 1056 0.0111202239194966
glioblastoma 5572 0.0187610194825807
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0356850416092315
Disease Target Count Z-score Confidence
Pervasive developmental disorder 4 0.0 2.0

Expression

Synonym

Accession Q9BSW7 O43330 Q9NZ18
Symbols sytXVII

Gene

PDB

2ENP  

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16672768 The results suggest that B/K proteins play a role as potential substrates for PKA in the area where they are expressed.

AA Sequence

MAYIQLEPLNEGFLSRISGLLLCRWTCRHCCQKCYESSCCQSSEDEVEILGPFPAQTPPWLMASRSSDKD      1 - 70
GDSVHTASEVPLTPRTNSPDGRRSSSDTSKSTYSLTRRISSLESRRPSSPLIDIKPIEFGVLSAKKEPIQ     71 - 140
PSVLRRTYNPDDYFRKFEPHLYSLDSNSDDVDSLTDEEILSKYQLGMLHFSTQYDLLHNHLTVRVIEARD    141 - 210
LPPPISHDGSRQDMAHSNPYVKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVD    211 - 280
FDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQNEVELGELLLSLNYLPSAGRLNVDVIRAKQLLQ    281 - 350
TDVSQGSDPFVKIQLVHGLKLVKTKKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSND    351 - 420
FIGRIVIGQYSSGPSETNHWRRMLNTHRTAVEQWHSLRSRAECDRVSPASLEVT                    421 - 474
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
21876473 2011 Confirmation of prior evidence of genetic susceptibility to alcoholism in a genome-wide association study of comorbid alcoholism and bipolar disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16672768 2006 Protein kinase A-dependent phosphorylation of B/K protein.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...