Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.07
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 2.3e-02
Chronic Lymphocytic Leukemia 1.057 4.3e-03
cutaneous lupus erythematosus -1.200 1.1e-02
glioblastoma -1.500 1.9e-02
group 3 medulloblastoma -2.100 1.1e-02
interstitial cystitis -1.600 7.2e-04
intraductal papillary-mucinous adenoma (... 1.300 2.8e-03
intraductal papillary-mucinous neoplasm ... 1.700 3.6e-02
invasive ductal carcinoma 1.400 7.2e-03
lung carcinoma 1.400 3.8e-21
malignant mesothelioma 1.100 1.3e-05
medulloblastoma, large-cell -2.800 6.2e-04
ovarian cancer -1.300 7.6e-03
pituitary cancer -2.600 3.1e-05
psoriasis -1.200 5.2e-09

Gene RIF (2)

AA Sequence

MAYIQLEPLNEGFLSRISGLLLCRWTCRHCCQKCYESSCCQSSEDEVEILGPFPAQTPPWLMASRSSDKD      1 - 70
GDSVHTASEVPLTPRTNSPDGRRSSSDTSKSTYSLTRRISSLESRRPSSPLIDIKPIEFGVLSAKKEPIQ     71 - 140
PSVLRRTYNPDDYFRKFEPHLYSLDSNSDDVDSLTDEEILSKYQLGMLHFSTQYDLLHNHLTVRVIEARD    141 - 210
LPPPISHDGSRQDMAHSNPYVKICLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVD    211 - 280
FDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQNEVELGELLLSLNYLPSAGRLNVDVIRAKQLLQ    281 - 350
TDVSQGSDPFVKIQLVHGLKLVKTKKTSFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSND    351 - 420
FIGRIVIGQYSSGPSETNHWRRMLNTHRTAVEQWHSLRSRAECDRVSPASLEVT                    421 - 474
//

Text Mined References (12)

PMID Year Title