Property Summary

NCBI Gene PubMed Count 8
Grant Count 7
Funding $551,066.91
PubMed Score 11.07
PubTator Score 14.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.300 0.000

Gene RIF (5)

PMID Text
22292636 ARD1 protein was observed at 61.0% (50/82), 54.7% (87/159), 37.9% (25/66), 36.8% (7/19) in IDC, fibroadenoma, hyperplasia, and inflammation, respectively.
22048246 NAA11 expression is tissue-specific and is epigenetically regulated by DNA methylation.
20419844 LOH in genes around D4S2964, including ARD1B and SEPT11 may play an important role in hepatocellular carcinoma development and progression
16638120 hARD2, an N-alpha-acetyltransferase has 81 % sequence identity to hARD1. Its gene may originate from a eutherian-mammal-specific retrotransposition event. hARD2-NATH complexes may be responsible for protein N-alpha-acetylation in human cells.
16638120 hARD2 (MGC10646) is a novel human protein N-alpha acetyltransferase

AA Sequence

MNIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEEPDDVPHG      1 - 70
HITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRPALHLYSNTLNFQISEVEPKYYAD     71 - 140
GEDAYAMKRDLSQMADELRRQMDLKKGGYVVLGSRENQETQGSTLSDSEEACQQKNPATEESGSDSKEPK    141 - 210
ESVESTNVQDSSESSDSTS                                                       211 - 229
//

Publication (10)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22292636 2011 Up-regulation of human arrest-defective 1 protein is correlated with metastatic phenotype and poor prognosis in breast cancer.
22048246 2011 Expression of human NAA11 (ARD1B) gene is tissue-specific and is regulated by DNA methylation.
20419844 2010 LOH analysis of genes around D4S2964 identifies ARD1B as a prognostic predictor of hepatocellular carcinoma.
19660095 2009 A synopsis of eukaryotic Nalpha-terminal acetyltransferases: nomenclature, subunits and substrates.
19480662 2009 A novel human NatA Nalpha-terminal acetyltransferase complex: hNaa16p-hNaa10p (hNat2-hArd1).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16638120 2006 Characterization of hARD2, a processed hARD1 gene duplicate, encoding a human protein N-alpha-acetyltransferase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.