Property Summary

NCBI Gene PubMed Count 8
PubMed Score 13.07
PubTator Score 14.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.300 1.1e-05

Synonym

Accession Q9BSU3 Q66K19 Q6P479
Symbols ARD2
ARD1B
hARD2

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MNIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEEPDDVPHG      1 - 70
HITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRPALHLYSNTLNFQISEVEPKYYAD     71 - 140
GEDAYAMKRDLSQMADELRRQMDLKKGGYVVLGSRENQETQGSTLSDSEEACQQKNPATEESGSDSKEPK    141 - 210
ESVESTNVQDSSESSDSTS                                                       211 - 229
//

Text Mined References (10)

PMID Year Title