Property Summary

NCBI Gene PubMed Count 27
PubMed Score 22.63
PubTator Score 14.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.79415928462631E-13
atypical teratoid / rhabdoid tumor 4369 1.48471704894817E-5
glioblastoma 5572 1.78462468130206E-5
medulloblastoma, large-cell 6234 2.22960139011375E-5
pilocytic astrocytoma 3086 6.70690602672576E-5
ovarian cancer 8492 2.13051695409163E-4
adult high grade glioma 2148 0.00173187530888445
Pick disease 1893 0.00450512194961199
invasive ductal carcinoma 2950 0.0053315278770118
ductal carcinoma in situ 1745 0.00605012871599959
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0133016756525778
subependymal giant cell astrocytoma 2287 0.0144102550043802
astrocytic glioma 2241 0.0146830588060622
sonic hedgehog group medulloblastoma 1482 0.0194714877734799
oligodendroglioma 2849 0.0253364894916545
active Crohn's disease 918 0.0258989571494608
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0335321858637251
Disease Target Count Z-score Confidence
Amyotrophic neuralgia 13 3.492 1.7

Expression

Synonym

Accession Q9BST9 H7BXD4 Q8WVN1 Q96PT6 Q9HB05
Symbols

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA Inparanoid
C. elegans EggNOG Inparanoid

Gene RIF (10)

PMID Text
26349972 RTKN could affect the proliferation and metastasis of colon cancer by reducing expression of MCM2/3/5, CDK1/2 and PCNA
22964635 suggest that interaction of S100A4 and Rhotekin permits S100A4 to complex with RhoA and switch Rho function from stress fiber formation to membrane ruffling to confer an invasive phenotypea
22228765 Protein kinase D regulates RhoA activity via phosphorylation rhotekin at Ser-435.
19360360 Loss of miR-145 may provide a selective growth advantage for MCF-7 by targeting RTKN.
19294487 Rhotekin forms a complex with vinexin and may play a role at focal adhesions.
17546647 SEPT9 sequence alternations causing hereditary neuralgic amyotrophy are associated with altered interactions with SEPT4/SEPT11 and resistance to Rho/Rhotekin-signaling
16979770 Lin-7B is a binding partner for Rhotekin in the human brain cDNA library
15599595 These results suggest that the RTKN gene is involved in bladder carcinogenesis and progression in bladder carcinoma, indicating that RTKN gene could be a molecular target in cancer therapy.
15480428 overexpression may play a key role in gastric tumorigenesis by conferring cells resistance to apoptosis
15316142 Rho/RTKN-mediated NF-kappaB activation leading to cell survival may play a key role in gastric tumorigenesis.

AA Sequence

MFSRNHRSRVTVARGSALEMEFKRGRFRLSLFSDLPEDTELQRKLDHEIRMREGACKLLAACSQREQALE      1 - 70
ATKSLLVCNSRILSYMGELQRRKEAQVLGKTSRRPSDSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKN     71 - 140
KGDLHRWAVFLLLQLGEHIQDTEMILVDRTLTDISFQSNVLFAEAGPDFELRLELYGACVEEEGALTGGP    141 - 210
KRLATKLSSSLGRSSGRRVRASLDSAGGSGSSPILLPTPVVGGPRYHLLAHTTLTLAAVQDGFRTHDLTL    211 - 280
ASHEENPAWLPLYGSVCCRLAAQPLCMTQPTASGTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADT    281 - 350
GEEPLLTIAVNKETRVRAGELDQALGRPFTLSISNQYGDDEVTHTLQTESREALQSWMEALWQLFFDMSQ    351 - 420
WKQCCDEIMKIETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPPPWLAMFTDQP    421 - 490
ALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPPQRSPRTRGLCSKGQPRTWLQ    491 - 560
SPV                                                                       561 - 563
//

Text Mined References (33)

PMID Year Title
26349972 2015 Effect of RTKN on progression and metastasis of colon cancer in vitro.
24525234 2014 The RhoGEF GEF-H1 is required for oncogenic RAS signaling via KSR-1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22964635 2013 Coupling S100A4 to Rhotekin alters Rho signaling output in breast cancer cells.
22705156 2012 WNT-3a modulates platelet function by regulating small GTPase activity.
22621765 2012 Distinct biological activities of C3 and ADP-ribosyltransferase-deficient C3-E174Q.
22228765 2012 Protein kinase D regulates RhoA activity via rhotekin phosphorylation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...