Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.13
PubTator Score 4.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
hepatocellular carcinoma 550 7.31551928258962E-7
tuberculosis and treatment for 6 months 686 3.78240254003544E-6
atypical teratoid / rhabdoid tumor 4369 8.25043309270082E-6
glioblastoma 5572 1.80181480782812E-5
pilocytic astrocytoma 3086 2.23427388290841E-5
osteosarcoma 7933 3.65365209127648E-5
pediatric high grade glioma 2712 7.97913815191993E-5

Expression

  Differential Expression (7)

Disease log2 FC p
hepatocellular carcinoma 1.400 0.000
osteosarcoma -1.632 0.000
glioblastoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
tuberculosis and treatment for 6 months -1.600 0.000
pediatric high grade glioma 1.200 0.000
pilocytic astrocytoma 1.200 0.000

Synonym

Accession Q9BSR8
Symbols FinGER4
Nbla11189

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (2)

PMID Text
26235900 YIPF4 is a binding partner of the papillomavirus E5 proteins.
21757827 YIPF4 was detected as a single mobility form consistent with its predicted molecular weight, three different mobility forms of YIPF3 were detected by western blotting.

AA Sequence

MQPPGPPPAYAPTNGDFTFVSSADAEDLSGSIASPDVKLNLGGDFIKESTATTFLRQRGYGWLLEVEDDD      1 - 70
PEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLFFSMISLYGQFRVVSWI     71 - 140
ITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLPLIVIAPVLLVVGSFEVVSTLIKLFGVFWAAYSA    141 - 210
ASLLVGEEFKTKKPLLIYPIFLLYIYFLSLYTGV                                        211 - 244
//

Text Mined References (15)

PMID Year Title
26235900 2015 YIP1 family member 4 (YIPF4) is a novel cellular binding partner of the papillomavirus E5 proteins.
25416956 2014 A proteome-scale map of the human interactome network.
21757827 2011 Characterization of YIPF3 and YIPF4, cis-Golgi Localizing Yip domain family proteins.
21269460 2011 Initial characterization of the human central proteome.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...