Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.13
PubTator Score 4.87

Knowledge Summary


No data available


  Differential Expression (7)

Disease log2 FC p
hepatocellular carcinoma 1.400 0.000
osteosarcoma -1.632 0.000
glioblastoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
tuberculosis and treatment for 6 months -1.600 0.000
pediatric high grade glioma 1.200 0.000
pilocytic astrocytoma 1.200 0.000

Gene RIF (2)

26235900 YIPF4 is a binding partner of the papillomavirus E5 proteins.
21757827 YIPF4 was detected as a single mobility form consistent with its predicted molecular weight, three different mobility forms of YIPF3 were detected by western blotting.

AA Sequence

ASLLVGEEFKTKKPLLIYPIFLLYIYFLSLYTGV                                        211 - 244

Publication (15)

PMID Year Title
26235900 2015 YIP1 family member 4 (YIPF4) is a novel cellular binding partner of the papillomavirus E5 proteins.
25416956 2014 A proteome-scale map of the human interactome network.
21757827 2011 Characterization of YIPF3 and YIPF4, cis-Golgi Localizing Yip domain family proteins.
21269460 2011 Initial characterization of the human central proteome.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.