Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.13
PubTator Score 1.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (1)

AA Sequence

MTVQRLVAAAVLVALVSLILNNVAAFTSNWVCQTLEDGRRRSVGLWRSCWLVDRTRGGPSPGARAGQVDA      1 - 70
HDCEALGWGSEAAGFQESRGTVKLQFDMMRACNLVATAALTAGQLTFLLGLVGLPLLSPDAPCWEEAMAA     71 - 140
AFQLASFVLVIGLVTFYRIGPYTNLSWSCYLNIGACLLATLAAAMLIWNILHKREDCMAPRVIVISRSLT    141 - 210
ARFRRGLDNDYVESPC                                                          211 - 226
//

Text Mined References (7)

PMID Year Title