Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.13
PubTator Score 1.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 7.53850810717548E-19
non-small cell lung cancer 2798 6.27477942381192E-18
malignant mesothelioma 3163 1.63881312379019E-8
sarcoidosis 368 1.27320786010988E-5
ulcerative colitis 2087 2.62047201125354E-5
nephrosclerosis 329 6.20640286031493E-5
pilocytic astrocytoma 3086 6.70690602672576E-5
pancreatic cancer 2300 8.75661338005826E-5
lung cancer 4473 2.46799704371408E-4
adrenocortical carcinoma 1427 3.66789885124729E-4
primary pancreatic ductal adenocarcinoma 1271 3.71724405160157E-4
invasive ductal carcinoma 2950 6.03380244348703E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.1036722603067E-4
ovarian cancer 8492 7.74567572004838E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00172584651666636
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00245355184593432
sonic hedgehog group medulloblastoma 1482 0.00476999105498814

Expression

Synonym

Accession Q9BSN7 D3DU76 Q3KRC1 Q9H7G5
Symbols CLP24
C16orf30

Gene

  Ortholog (10)

Gene RIF (1)

PMID Text
15206924 suggests that CLP24 is a novel, hypoxically regulated tetraspan adherens junction protein that modulates cell adhesion, paracellular permeability and angiogenesis

AA Sequence

MTVQRLVAAAVLVALVSLILNNVAAFTSNWVCQTLEDGRRRSVGLWRSCWLVDRTRGGPSPGARAGQVDA      1 - 70
HDCEALGWGSEAAGFQESRGTVKLQFDMMRACNLVATAALTAGQLTFLLGLVGLPLLSPDAPCWEEAMAA     71 - 140
AFQLASFVLVIGLVTFYRIGPYTNLSWSCYLNIGACLLATLAAAMLIWNILHKREDCMAPRVIVISRSLT    141 - 210
ARFRRGLDNDYVESPC                                                          211 - 226
//

Text Mined References (7)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15206924 2004 A novel four transmembrane spanning protein, CLP24. A hypoxically regulated cell junction protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12136098 2002 NotI flanking sequences: a tool for gene discovery and verification of the human genome.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.