Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.35
PubTator Score 5.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.300 1.7e-03
atypical teratoid / rhabdoid tumor 1.900 4.6e-09
glioblastoma 2.000 1.2e-05
group 4 medulloblastoma 1.100 5.1e-03
medulloblastoma, large-cell 2.200 5.4e-07
psoriasis -1.700 1.2e-04
Rheumatoid arthritis -1.300 1.4e-03

 MGI Phenotype (1)

Gene RIF (4)

AA Sequence

MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKS      1 - 70
CIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTG     71 - 140
EEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHR    141 - 210
LMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR                         211 - 259
//

Text Mined References (23)

PMID Year Title