Property Summary

NCBI Gene PubMed Count 15
Grant Count 9
R01 Count 5
Funding $290,677.49
PubMed Score 9.70
PubTator Score 5.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis -2.700 0.000
psoriasis -1.700 0.000
atypical teratoid / rhabdoid tumor 1.900 0.000
glioblastoma 2.000 0.000
medulloblastoma 1.600 0.000
medulloblastoma, large-cell 2.200 0.000
adult high grade glioma 1.300 0.002

Gene RIF (3)

PMID Text
26687479 knockdown of PCGF1 results in reduced expression of DPPA4 and other subunits of the variant PRC1 complex at both mRNA and protein levels. Thus, PCGF1 represents a physical and functional link between Polycomb function and pluripotency
18976975 Knockdown of polycomb group ring finger 1 (PCGF1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
15315754 polycomb has a role in stem cell fate and development of cancer (review)

AA Sequence

MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKS      1 - 70
CIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTG     71 - 140
EEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHR    141 - 210
LMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR                         211 - 259
//

Text Mined References (18)

PMID Year Title
26687479 2015 The variant Polycomb Repressor Complex 1 component PCGF1 interacts with a pluripotency sub-network that includes DPPA4, a regulator of embryogenesis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
23523425 2013 Structure of the polycomb group protein PCGF1 in complex with BCOR reveals basis for binding selectivity of PCGF homologs.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17088287 2006 NSPc1 is a cell growth regulator that acts as a transcriptional repressor of p21Waf1/Cip1 via the RARE element.
16943429 2006 Polycomb group and SCF ubiquitin ligases are found in a novel BCOR complex that is recruited to BCL6 targets.
More...