Property Summary

NCBI Gene PubMed Count 18
Grant Count 9
R01 Count 8
Funding $1,929,411
PubMed Score 358.44
PubTator Score 3.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.141 0.000
osteosarcoma -2.064 0.000
ovarian cancer 1.500 0.000

Gene RIF (1)

PMID Text
16310047 AIRE interacts with multiple components of the transcription complex including a novel interaction with the UBA domain protein, GBDR1.

AA Sequence

MFVQEEKIFAGKVLRLHICASDGAEWLEEATEDTSVEKLKERCLKHCAHGSLEDPKSITHHKLIHAASER      1 - 70
VLSDARTILEENIQDQDVLLLIKKRAPSPLPKMADVSAEEKKKQDQKAPDKEAILRATANLPSYNMDRAA     71 - 140
VQTNMRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEDERVDEAALRQLTEMGFPENRA    141 - 210
TKALQLNHMSVPQAMEWLIEHAEDPTIDTPLPGQAPPEAEGATAAASEAAAGASATDEEARDELTEIFKK    211 - 280
IRRKREFRADARAVISLMEMGFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELDKGIDPDSPLFQAI    281 - 350
LDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT                   351 - 405
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16310047 2006 AIRE recruits multiple transcriptional components to specific genomic regions through tethering to nuclear matrix.
More...