Property Summary

NCBI Gene PubMed Count 18
PubMed Score 358.44
PubTator Score 3.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.13567095647831E-6
Multiple myeloma 1328 4.43836172091687E-5
ovarian cancer 8492 9.56719802390445E-5
Disease Target Count Z-score Confidence
Acute cystitis 37 4.395 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.141 0.000
osteosarcoma -2.064 0.000
ovarian cancer 1.500 0.000

Synonym

Accession Q9BSL1 O75500 Q9UMW7 UBA domain-containing protein 1
Symbols KPC2
GBDR1
UBADC1

Gene

PDB

2DAI  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
16310047 AIRE interacts with multiple components of the transcription complex including a novel interaction with the UBA domain protein, GBDR1.

AA Sequence

MFVQEEKIFAGKVLRLHICASDGAEWLEEATEDTSVEKLKERCLKHCAHGSLEDPKSITHHKLIHAASER      1 - 70
VLSDARTILEENIQDQDVLLLIKKRAPSPLPKMADVSAEEKKKQDQKAPDKEAILRATANLPSYNMDRAA     71 - 140
VQTNMRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEDERVDEAALRQLTEMGFPENRA    141 - 210
TKALQLNHMSVPQAMEWLIEHAEDPTIDTPLPGQAPPEAEGATAAASEAAAGASATDEEARDELTEIFKK    211 - 280
IRRKREFRADARAVISLMEMGFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELDKGIDPDSPLFQAI    281 - 350
LDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT                   351 - 405
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16310047 2006 AIRE recruits multiple transcriptional components to specific genomic regions through tethering to nuclear matrix.
More...