Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.92
PubTator Score 6.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.6e-08
Disease Target Count Z-score Confidence
Keshan disease 17 3.952 2.0
Rhabdomyosarcoma 39 3.27 1.6
Hyperandrogenism 34 3.099 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.175 1.6e-08

Gene RIF (11)

AA Sequence

MDLRTAVYNAARDGKLQLLQKLLSGRSREELDELTGEVAGGGTPLLIAARYGHLDVVEYLVDRCGASVEA      1 - 70
GGSVHFDGETIEGAPPLWAASAAGHLDVVRSLLRRGASVNRTTRTNSTPLRAACFDGHLEVVRYLVGEHQ     71 - 140
ADLEVANRHGHTCLMISCYKGHREIARYLLEQGAQVNRRSAKGNTALHDCAESGSLEILQLLLGCKARME    141 - 210
RDGYGMTPLLAASVTGHTNIVEYLIQEQPGQEQVAGGEAQPGLPQEDPSTSQGCAQPQGAPCCSSSPEEP    211 - 280
LNGESYESCCPTSREAAVEALELLGATYVDKKRDLLGALKHWRRAMELRHQGGEYLPKPEPPQLVLAYDY    281 - 350
SREVNTTEELEALITDPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFERCIRLWKYALDMQ    351 - 420
QSNLEPLSPMTASSFLSFAELFSYVLQDRAAKGSLGTQIGFADLMGVLTKGVREVERALQLPREPGDSAQ    421 - 490
FTKALAIILHLLYLLEKVECTPSQEHLKHQTVYRLLKCAPRGKNGFTPLHMAVDKDTTNVGRYPVGRFPS    491 - 560
LHVVKVLLDCGADPDSRDFDNNTPLHIAAQNNCPAIMNALIEAGAHMDATNAFKKTAYELLDEKLLARGT    561 - 630
MQPFNYVTLQCLAARALDKNKIPYKGFIPEDLEAFIELH                                   631 - 669
//

Text Mined References (19)

PMID Year Title