Property Summary

NCBI Gene PubMed Count 15
Grant Count 4
R01 Count 4
Funding $188,133
PubMed Score 6.20
PubTator Score 6.56

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.175 0.000

Gene RIF (10)

PMID Text
22678803 Particular genotypes of the rs12460989 and rs8111933 loci of FEM1A gene are associated with PCOS in Chinese Han.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20200332 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18757445 This study presents evidence suggesting a role for FEM1A and FEM1B in the pathogenesis of polycystic ovary syndrome.
18757445 Observational study of gene-disease association. (HuGE Navigator)
18270204 PGE(2)-EP4 signaling augments NF-kappaB1 p105 protein stability through EPRAP after proinflammatory stimulation, limiting macrophage activation.
16390781 Observational study of gene-disease association. (HuGE Navigator)
16254458 Fem1a downregulation may be involved in, and/or a marker of, an early cell fate defect fundamental to rhabdomyosarcoma pathogenesis

AA Sequence

MDLRTAVYNAARDGKLQLLQKLLSGRSREELDELTGEVAGGGTPLLIAARYGHLDVVEYLVDRCGASVEA      1 - 70
GGSVHFDGETIEGAPPLWAASAAGHLDVVRSLLRRGASVNRTTRTNSTPLRAACFDGHLEVVRYLVGEHQ     71 - 140
ADLEVANRHGHTCLMISCYKGHREIARYLLEQGAQVNRRSAKGNTALHDCAESGSLEILQLLLGCKARME    141 - 210
RDGYGMTPLLAASVTGHTNIVEYLIQEQPGQEQVAGGEAQPGLPQEDPSTSQGCAQPQGAPCCSSSPEEP    211 - 280
LNGESYESCCPTSREAAVEALELLGATYVDKKRDLLGALKHWRRAMELRHQGGEYLPKPEPPQLVLAYDY    281 - 350
SREVNTTEELEALITDPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFERCIRLWKYALDMQ    351 - 420
QSNLEPLSPMTASSFLSFAELFSYVLQDRAAKGSLGTQIGFADLMGVLTKGVREVERALQLPREPGDSAQ    421 - 490
FTKALAIILHLLYLLEKVECTPSQEHLKHQTVYRLLKCAPRGKNGFTPLHMAVDKDTTNVGRYPVGRFPS    491 - 560
LHVVKVLLDCGADPDSRDFDNNTPLHIAAQNNCPAIMNALIEAGAHMDATNAFKKTAYELLDEKLLARGT    561 - 630
MQPFNYVTLQCLAARALDKNKIPYKGFIPEDLEAFIELH                                   631 - 669
//

Text Mined References (18)

PMID Year Title
22678803 2012 [Polymorphisms of FEM1A gene in patients with polycystic ovary syndrome].
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20200332 2010 Family-based analysis of candidate genes for polycystic ovary syndrome.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18757445 2008 FEM1A and FEM1B: novel candidate genes for polycystic ovary syndrome.
18270204 2008 Prostaglandin E receptor type 4-associated protein interacts directly with NF-kappaB1 and attenuates macrophage activation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16424369 2006 A novel prostaglandin E receptor 4-associated protein participates in antiinflammatory signaling.
16390781 2005 FEM1A is a candidate gene for polycystic ovary syndrome.
More...