Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.54
PubTator Score 12.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Schnyder Corneal Dystrophy 23 4.401 2.2

Expression

Gene RIF (5)

AA Sequence

MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSV      1 - 70
TPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNIVHIFSAGSAAF     71 - 140
ITNSLMNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTASYAGISETIICFAIYESL    141 - 210
KKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFR    211 - 280
EEGYLAFYRGLFAQLIRQIPNTAIVLSTYELIVYLLEDRTQ                                 281 - 321
//

Text Mined References (12)

PMID Year Title