Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.49
PubTator Score 12.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Schnyder corneal dystrophy 23 4.431 2.2

Expression

Synonym

Accession Q9BSK2
Symbols PNC1
BMSC-MCP

Gene

Gene RIF (5)

PMID Text
25320081 The main physiological role of SLC25A33 and SLC25A36 is to import/export pyrimidine nucleotides into and from mitochondria
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20453889 PNC1 is essential for mitochondria maintenance.
14715278 BMSC-MCP is a phylogenetically conserved and widely expressed mitochondrial carrier protein which perhaps associates with mitochondrial oxidative phosphorylation

AA Sequence

MATGGQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSV      1 - 70
TPGLFQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNIVHIFSAGSAAF     71 - 140
ITNSLMNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTASYAGISETIICFAIYESL    141 - 210
KKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHEVIRTRLREEGTKYKSFVQTARLVFR    211 - 280
EEGYLAFYRGLFAQLIRQIPNTAIVLSTYELIVYLLEDRTQ                                 281 - 321
//

Text Mined References (12)

PMID Year Title
25320081 2014 The human SLC25A33 and SLC25A36 genes of solute carrier family 25 encode two mitochondrial pyrimidine nucleotide transporters.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20453889 2010 Mitochondrial pyrimidine nucleotide carrier (PNC1) regulates mitochondrial biogenesis and the invasive phenotype of cancer cells.
17596519 2007 The insulin-like growth factor-I-mTOR signaling pathway induces the mitochondrial pyrimidine nucleotide carrier to promote cell growth.
16949250 2006 Fourteen novel human members of mitochondrial solute carrier family 25 (SLC25) widely expressed in the central nervous system.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14715278 2004 HuBMSC-MCP, a novel member of mitochondrial carrier superfamily, enhances dendritic cell endocytosis.
More...