Property Summary

NCBI Gene PubMed Count 11
PubMed Score 39.15
PubTator Score 31.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.2e-04
atypical teratoid / rhabdoid tumor 1.700 5.5e-07
glioblastoma 1.100 1.6e-03
medulloblastoma, large-cell 1.100 3.3e-03
ovarian cancer -1.300 2.3e-07
pancreatic cancer 1.500 4.3e-03
pancreatic ductal adenocarcinoma liver m... 1.258 5.0e-03
sonic hedgehog group medulloblastoma 1.200 1.1e-03
tuberculosis 1.300 6.8e-06

Gene RIF (7)

AA Sequence

MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHFALFVSVLFWL      1 - 70
LTLGLYFLTLLGKHELVPVLGSRWLMVNVAHDVLAAALYGAATGIMSDQMQRHSYCNLKDYPLPCAYHAF     71 - 140
LAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA                                         141 - 173
//

Text Mined References (12)

PMID Year Title