Property Summary

NCBI Gene PubMed Count 9
PubMed Score 36.21
PubTator Score 31.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.27381336022707E-7
atypical teratoid / rhabdoid tumor 4369 5.49361050671759E-7
tuberculosis 1563 6.77902009547634E-6
pilocytic astrocytoma 3086 6.32740156077171E-5
sonic hedgehog group medulloblastoma 1482 0.00107685053514737
primary pancreatic ductal adenocarcinoma 1271 0.00155838663031755
glioblastoma 5572 0.00162434829725585
medulloblastoma, large-cell 6234 0.0032698702914238
pancreatic cancer 2300 0.00426921005584307
Disease Target Count Z-score Confidence
Facial paralysis 15 6.45 3.2

Expression

  Differential Expression (9)

Synonym

Accession Q9BSK0
Symbols GB14
MARVD1
MRVLDC1
bA548K23.8

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
26107903 Importin-beta1 mediates the non-classical nucleocytoplasmic transport of MARVELD1.
25520033 MARVELD1 silencing is an appealing diagnostic biomarker for lung cancer.
24055813 MARVELD1 plays a role in pre-mRNA processing of integrin beta1.
22320884 Our findings suggest that MARVELD1 is a tumor suppressor by negatively regulating proliferation, tumor growth and chemosensitivity of HCC cells via increasing p53 and p16 in vitro and in vivo.
19364627 MARVELD1 protein is located in nucleus instead of cell membrane in several different tumors, in males and in females.

AA Sequence

MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHFALFVSVLFWL      1 - 70
LTLGLYFLTLLGKHELVPVLGSRWLMVNVAHDVLAAALYGAATGIMSDQMQRHSYCNLKDYPLPCAYHAF     71 - 140
LAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA                                         141 - 173
//

Text Mined References (10)

PMID Year Title
26107903 [Importin-?1 plays a key role in the nucleocytoplasmic transportation process of MARVELD1].
25520033 2014 Biological and clinical significance of epigenetic silencing of MARVELD1 gene in lung cancer.
24055813 2013 MARVELD1 regulates integrin ?1-mediated cell adhesion and actin organization via inhibiting its pre-mRNA processing.
22320884 2012 MARVELD1 inhibited cell proliferation and enhance chemosensitivity via increasing expression of p53 and p16 in hepatocellular carcinoma.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
19364627 2009 Identification and characterization of MARVELD1, a novel nuclear protein that is down-regulated in multiple cancers and silenced by DNA methylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.