Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $75,029
PubMed Score 15.55
PubTator Score 63.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BSJ6 Q96CT4 Q9NVV1 Q9NWB5
Symbols CATS
RCS1

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
23419774 Moreover, we showed that CATS and KIS antagonize the transactivation capacity of CALM/AF10.In summary, our results show that CATS interacts with and is a substrate for KIS, suggesting that KIS regulates CATS function

AA Sequence

MASRWQNMGTSVRRRSLQHQEQLEDSKELQPVVSHQETSVGALGSLCRQFQRRLPLRAVNLNLRAGPSWK      1 - 70
RLETPEPGQQGLQAAARSAKSALGAVSQRIQESCQSGTKWLVETQVKARRRKRGAQKGSGSPTHSLSQKS     71 - 140
TRLSGAAPAHSAADPWEKEHHRLSVRMGSHAHPLRRSRREAAFRSPYSSTEPLCSPSESDSDLEPVGAGI    141 - 210
QHLQKLSQELDEAIMAEERKQALSDRQGFILKDVYASP                                    211 - 248
//

Text Mined References (17)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
23419774 2013 The CATS (FAM64A) protein is a substrate of the Kinase Interacting Stathmin (KIS).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19383357 2008 The CALM and CALM/AF10 interactor CATS is a marker for proliferation.
18757745 2008 RCS1, a substrate of APC/C, controls the metaphase to anaphase transition.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...