Property Summary

NCBI Gene PubMed Count 10
PubMed Score 19.21
PubTator Score 63.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma 1.222 2.1e-03
adult high grade glioma 1.800 1.2e-04
atypical teratoid / rhabdoid tumor 2.300 2.9e-07
Breast cancer 1.200 1.0e-10
ductal carcinoma in situ 1.100 1.4e-03
Endometriosis 1.039 1.5e-02
glioblastoma 2.200 6.2e-08
group 3 medulloblastoma 1.900 1.0e-05
invasive ductal carcinoma 1.400 8.8e-05
lung cancer 1.800 6.3e-04
malignant mesothelioma 3.100 4.2e-09
medulloblastoma, large-cell 2.400 1.1e-05
non-small cell lung cancer 1.626 5.8e-27
ovarian cancer 1.300 1.4e-05
posterior fossa group A ependymoma 1.200 1.1e-04
primitive neuroectodermal tumor 2.800 9.7e-07

Gene RIF (1)

AA Sequence

MASRWQNMGTSVRRRSLQHQEQLEDSKELQPVVSHQETSVGALGSLCRQFQRRLPLRAVNLNLRAGPSWK      1 - 70
RLETPEPGQQGLQAAARSAKSALGAVSQRIQESCQSGTKWLVETQVKARRRKRGAQKGSGSPTHSLSQKS     71 - 140
TRLSGAAPAHSAADPWEKEHHRLSVRMGSHAHPLRRSRREAAFRSPYSSTEPLCSPSESDSDLEPVGAGI    141 - 210
QHLQKLSQELDEAIMAEERKQALSDRQGFILKDVYASP                                    211 - 248
//

Text Mined References (17)

PMID Year Title