Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 286 2.4279043379816E-25
diabetes mellitus 1663 0.00169657397727139
group 3 medulloblastoma 2254 0.0176653947155977

AA Sequence

MNSGILQVFQRALTCPICMNYFLDPVTIDCGHSFCRPCLYLNWQDTAVLAQCSECKKTTRQRNLNTDICL      1 - 70
KNMAFIARKASLRQFLSSEEQICGMHRETKKMFCEVDKSLLCLPCSNSQEHRNHIHCPIEWAAEERREEL     71 - 140
LKKMQSLWEKACENLRNLNMETTRTRCWKDYVSLRIEAIRAEYQKMPAFLHEEEQHHLERLRKEGEDIFQ    141 - 210
QLNESKARMEHSRELLRGMYEDLKQMCHKADVELLQAFGDILHRYESLLLQVSEPVNPELSAGPITGLLD    211 - 280
SLSGFRVDFTLQPERANSHIFLCGDLRSMNVGCDPQDDPDITGKSECFLVWGAQAFTSGKYYWEVHMGDS    281 - 350
WNWAFGVCNNYWKEKRQNDKIDGEEGLFLLGCVKEDTHCSLFTTSPLVVQYVPRPTSTVGLFLDCEGRTV    351 - 420
SFVDVDQSSLIYTIPNCSFSPPLRPIFCCSHF                                          421 - 452
//

Text Mined References (5)

PMID Year Title
22144910 2011 Identification of a genomic reservoir for new TRIM genes in primate genomes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.