Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.17
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
pediatric high grade glioma 2712 1.31411152554042E-4
medulloblastoma, large-cell 6234 3.26260781605121E-4
interstitial cystitis 2299 9.24838967863312E-4
osteosarcoma 7933 0.00128964907632562
glioblastoma 5572 0.00247978084568371
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00783063354887584
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0204205971604207

Expression

Synonym

Accession Q9BSH5 B2RD47
Symbols C9orf158
2810435D12Rik

Gene

PANTHER Protein Class (1)

PDB

3K1Z  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG Inparanoid

 GO Function (1)

 GO Component (1)

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLT      1 - 70
SRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRR     71 - 140
LEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFL    141 - 210
VVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGL                                 211 - 251
//

Text Mined References (8)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19060904 2009 An empirical framework for binary interactome mapping.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.