Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.17
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.200 2.5e-03
interstitial cystitis -1.100 9.2e-04
intraductal papillary-mucinous carcinoma... 1.100 7.8e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.0e-02
medulloblastoma, large-cell -1.200 3.3e-04
osteosarcoma -1.164 1.3e-03
pediatric high grade glioma -1.300 1.3e-04

Synonym

Accession Q9BSH5 B2RD47
Symbols C9orf158
2810435D12Rik

Gene

PDB

3K1Z  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GO Component (1)

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLT      1 - 70
SRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRR     71 - 140
LEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFL    141 - 210
VVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGL                                 211 - 251
//

Text Mined References (8)

PMID Year Title