Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.17
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.200 2.5e-03
interstitial cystitis -1.100 9.2e-04
intraductal papillary-mucinous carcinoma... 1.100 7.8e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.0e-02
medulloblastoma, large-cell -1.200 3.3e-04
osteosarcoma -1.164 1.3e-03
pediatric high grade glioma -1.300 1.3e-04

 GO Function (1)

 GO Component (1)

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLT      1 - 70
SRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRR     71 - 140
LEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFL    141 - 210
VVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGL                                 211 - 251
//

Text Mined References (8)

PMID Year Title