Property Summary

NCBI Gene PubMed Count 10
PubMed Score 46.25
PubTator Score 33.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
tuberculosis and treatment for 6 months 686 1.75829194508145E-5
Disease Target Count Z-score Confidence
Cryptococcosis 14 4.627 2.3
Hypoparathyroidism 29 3.439 1.7

Synonym

Accession Q9BSG1 A8MWV7 B4DIR4 Q4ZFY6 Q96G44 Q9UMC5
Symbols A1-5
ZNF661
Zfp661

Gene

  Ortholog (3)

Species Source
Mouse OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid

AA Sequence

MAAVSPTTRCQESVTFEDVAVVFTDEEWSRLVPIQRDLYKEVMLENYNSIVSLGLPVPQPDVIFQLKRGD      1 - 70
KPWMVDLHGSEEREWPESVSLDWETKPEIHDASDKKSEGSLRECLGRQSPLCPKFEVHTPNGRMGTEKQS     71 - 140
PSGETRKKSLSRDKGLRRRRSALSREILTKERHQECSDCGKTFFDHSSLTRHQRTHTGEKPYDCRECGKA    141 - 210
FSHRSSLSRHLMSHTGESPYECSVCSKAFFDRSSLTVHQRIHTGEKPFQCNECGKAFFDRSSLTRHQRIH    211 - 280
TGESPYECHQCGKAFSQKSILTRHQLIHTGRKPYECNECGKAFYGVSSLNRHQKAHAGDPRYQCNECGKA    281 - 350
FFDRSSLTQHQKIHTGDKPYECSECGKAFSQRCRLTRHQRVHTGEKPFECTVCGKVFSSKSSVIQHQRRY    351 - 420
AKQGID                                                                    421 - 426
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16101389 2005 Expression, purification and partial characterization of the Krüppel-associated box (KRAB) from the human ZNF2 protein.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10575230 1999 The human KRAB/FPB containing zinc finger gene ZNF2 maps to chromosome 2q11.2.
8183940 1994 The Krüppel-associated box-A (KRAB-A) domain of zinc finger proteins mediates transcriptional repression.
1945843 1991 Members of the zinc finger protein gene family sharing a conserved N-terminal module.