Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.49
PubTator Score 2.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1795 4.60051774325495E-4
Disease Target Count Z-score Confidence
Pyelonephritis 12 4.1 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.150 0.000

Synonym

Accession Q9BSG0 Q2Z1P2
Symbols PAP21
C2orf7

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEP      1 - 70
PEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIP     71 - 140
ALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW                          141 - 188
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15498570 2004 N-glycosylation is required for efficient secretion of a novel human secreted glycoprotein, hPAP21.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.