Tbio | BTB/POZ domain-containing protein 10 |
Plays a major role as an activator of AKT family members by inhibiting PPP2CA-mediated dephosphorylation, thereby keeping AKTs activated. Plays a role in preventing motor neuronal death and accelerating the growth of pancreatic beta cells.
Comments
Disease | Target Count | P-value |
---|---|---|
ependymoma | 2514 | 6.22160924679176E-12 |
atypical teratoid / rhabdoid tumor | 4369 | 8.31610035759282E-7 |
medulloblastoma | 1524 | 1.05813778603377E-6 |
glioblastoma | 5572 | 3.51654103640269E-6 |
pilocytic astrocytoma | 3086 | 1.89556606545072E-5 |
osteosarcoma | 7933 | 3.82888683285403E-5 |
medulloblastoma, large-cell | 6234 | 9.05697815987063E-5 |
adult high grade glioma | 2148 | 8.33157356694048E-4 |
primary pancreatic ductal adenocarcinoma | 1271 | 0.0012817867722408 |
astrocytic glioma | 2241 | 0.00128839594931819 |
Breast cancer | 3099 | 0.0286046184439493 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.0356719360441794 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Amyotrophic Lateral Sclerosis | 432 | 3.27 | 1.6 |
Disease | log2 FC | p |
---|---|---|
astrocytic glioma | -1.500 | 0.001 |
ependymoma | -1.300 | 0.000 |
osteosarcoma | -1.195 | 0.000 |
atypical teratoid / rhabdoid tumor | -1.500 | 0.000 |
glioblastoma | -1.500 | 0.000 |
medulloblastoma | -1.400 | 0.000 |
medulloblastoma, large-cell | -1.900 | 0.000 |
primary pancreatic ductal adenocarcinoma | 1.374 | 0.001 |
intraductal papillary-mucinous neoplasm ... | 1.900 | 0.036 |
Breast cancer | 2.500 | 0.029 |
adult high grade glioma | -1.200 | 0.001 |
pilocytic astrocytoma | -1.100 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
23320755 | findings suggest that reduced BTBD10 expression is closely linked to the pathogenesis of sporadic amyotrophic lateral sclerosis |
22388351 | Collectively, these results suggest that the reduced expression of BTBD10 leads to motor neuron death both in vitro and in vivo. |
21267538 | GMRP1 regulates pancreatic beta cell proliferation and apoptosis via activation of Akt signalling pathway. |
20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) |
18160256 | BTBD10 appears to behave as a suppressor of cell death including neuronal cell death related to amyotrophic lateral sclerosis and an enhancer of cell growth via its positive regulation of Akt phosphorylation. |
MAGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSLHGASGGHERSRDRRRSSDR 1 - 70 SRDSSHERTESQLTPCIRNVTSPTRQHHVEREKDHSSSRPSSPRPQKASPNGSISSAGNSSRNSSQSSSD 71 - 140 GSCKTAGEMVFVYENAKEGARNIRTSERVTLIVDNTRFVVDPSIFTAQPNTMLGRMFGSGREHNFTRPNE 141 - 210 KGEYEVAEGIGSTVFRAILDYYKTGIIRCPDGISIPELREACDYLCISFEYSTIKCRDLSALMHELSNDG 211 - 280 ARRQFEFYLEEMILPLMVASAQSGERECHIVVLTDDDVVDWDEEYPPQMGEEYSQIIYSTKLYRFFKYIE 281 - 350 NRDVAKSVLKERGLKKIRLGIEGYPTYKEKVKKRPGGRPEVIYNYVQRPFIRMSWEKEEGKSRHVDFQCV 351 - 420 KSKSITNLAAAAADIPQDQLVVMHPTPQVDELDILPIHPPSGNSDLDPDAQNPML 421 - 475 //
PMID | Year | Title |
---|---|---|
23320755 | 2013 | Reduced expression of BTBD10 in anterior horn cells with Golgi fragmentation and pTDP-43-positive inclusions in patients with sporadic amyotrophic lateral sclerosis. |
22388351 | 2012 | Reduced expression of BTBD10, an Akt activator, leads to motor neuron death. |
21406692 | 2011 | System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. |
21267538 | 2011 | Glucose metabolism-related protein 1 (GMRP1) regulates pancreatic beta cell proliferation and apoptosis via activation of Akt signalling pathway in rats and mice. |
20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | |
18160256 | 2008 | A novel Akt/PKB-interacting protein promotes cell adhesion and inhibits familial amyotrophic lateral sclerosis-linked mutant SOD1-induced neuronal death via inhibition of PP2A-mediated dephosphorylation of Akt/PKB. |
18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. |
17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. |
16554811 | 2006 | Human chromosome 11 DNA sequence and analysis including novel gene identification. |
16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. |
More... |