Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.30
PubTator Score 5.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 8.3e-04
astrocytic glioma -1.500 1.3e-03
Astrocytoma, Pilocytic -1.100 1.9e-05
atypical teratoid / rhabdoid tumor -1.500 8.3e-07
Breast cancer 2.500 2.9e-02
ependymoma -1.100 6.9e-03
glioblastoma -1.500 3.5e-06
intraductal papillary-mucinous neoplasm ... 1.900 3.6e-02
medulloblastoma -1.400 1.1e-06
medulloblastoma, large-cell -1.900 9.1e-05
osteosarcoma -1.195 3.8e-05
primary pancreatic ductal adenocarcinoma 1.374 1.3e-03

Synonym

Accession Q9BSF8 B7Z228 Q86WG1
Symbols GMRP1
GMRP-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MAGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSLHGASGGHERSRDRRRSSDR      1 - 70
SRDSSHERTESQLTPCIRNVTSPTRQHHVEREKDHSSSRPSSPRPQKASPNGSISSAGNSSRNSSQSSSD     71 - 140
GSCKTAGEMVFVYENAKEGARNIRTSERVTLIVDNTRFVVDPSIFTAQPNTMLGRMFGSGREHNFTRPNE    141 - 210
KGEYEVAEGIGSTVFRAILDYYKTGIIRCPDGISIPELREACDYLCISFEYSTIKCRDLSALMHELSNDG    211 - 280
ARRQFEFYLEEMILPLMVASAQSGERECHIVVLTDDDVVDWDEEYPPQMGEEYSQIIYSTKLYRFFKYIE    281 - 350
NRDVAKSVLKERGLKKIRLGIEGYPTYKEKVKKRPGGRPEVIYNYVQRPFIRMSWEKEEGKSRHVDFQCV    351 - 420
KSKSITNLAAAAADIPQDQLVVMHPTPQVDELDILPIHPPSGNSDLDPDAQNPML                   421 - 475
//

Text Mined References (14)

PMID Year Title