Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.25
PubTator Score 5.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 6.22160924679176E-12
atypical teratoid / rhabdoid tumor 4369 8.31610035759282E-7
medulloblastoma 1524 1.05813778603377E-6
glioblastoma 5572 3.51654103640269E-6
pilocytic astrocytoma 3086 1.89556606545072E-5
osteosarcoma 7933 3.82888683285403E-5
medulloblastoma, large-cell 6234 9.05697815987063E-5
adult high grade glioma 2148 8.33157356694048E-4
primary pancreatic ductal adenocarcinoma 1271 0.0012817867722408
astrocytic glioma 2241 0.00128839594931819
Breast cancer 3099 0.0286046184439493
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0356719360441794
Disease Target Count Z-score Confidence
Amyotrophic Lateral Sclerosis 432 3.27 1.6

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.500 0.001
ependymoma -1.300 0.000
osteosarcoma -1.195 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.500 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.900 0.000
primary pancreatic ductal adenocarcinoma 1.374 0.001
intraductal papillary-mucinous neoplasm ... 1.900 0.036
Breast cancer 2.500 0.029
adult high grade glioma -1.200 0.001
pilocytic astrocytoma -1.100 0.000

Synonym

Accession Q9BSF8 B7Z228 Q86WG1
Symbols GMRP1
GMRP-1

Gene

  Ortholog (12)

Gene RIF (5)

PMID Text
23320755 findings suggest that reduced BTBD10 expression is closely linked to the pathogenesis of sporadic amyotrophic lateral sclerosis
22388351 Collectively, these results suggest that the reduced expression of BTBD10 leads to motor neuron death both in vitro and in vivo.
21267538 GMRP1 regulates pancreatic beta cell proliferation and apoptosis via activation of Akt signalling pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18160256 BTBD10 appears to behave as a suppressor of cell death including neuronal cell death related to amyotrophic lateral sclerosis and an enhancer of cell growth via its positive regulation of Akt phosphorylation.

AA Sequence

MAGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSLHGASGGHERSRDRRRSSDR      1 - 70
SRDSSHERTESQLTPCIRNVTSPTRQHHVEREKDHSSSRPSSPRPQKASPNGSISSAGNSSRNSSQSSSD     71 - 140
GSCKTAGEMVFVYENAKEGARNIRTSERVTLIVDNTRFVVDPSIFTAQPNTMLGRMFGSGREHNFTRPNE    141 - 210
KGEYEVAEGIGSTVFRAILDYYKTGIIRCPDGISIPELREACDYLCISFEYSTIKCRDLSALMHELSNDG    211 - 280
ARRQFEFYLEEMILPLMVASAQSGERECHIVVLTDDDVVDWDEEYPPQMGEEYSQIIYSTKLYRFFKYIE    281 - 350
NRDVAKSVLKERGLKKIRLGIEGYPTYKEKVKKRPGGRPEVIYNYVQRPFIRMSWEKEEGKSRHVDFQCV    351 - 420
KSKSITNLAAAAADIPQDQLVVMHPTPQVDELDILPIHPPSGNSDLDPDAQNPML                   421 - 475
//

Text Mined References (14)

PMID Year Title
23320755 2013 Reduced expression of BTBD10 in anterior horn cells with Golgi fragmentation and pTDP-43-positive inclusions in patients with sporadic amyotrophic lateral sclerosis.
22388351 2012 Reduced expression of BTBD10, an Akt activator, leads to motor neuron death.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21267538 2011 Glucose metabolism-related protein 1 (GMRP1) regulates pancreatic beta cell proliferation and apoptosis via activation of Akt signalling pathway in rats and mice.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18160256 2008 A novel Akt/PKB-interacting protein promotes cell adhesion and inhibits familial amyotrophic lateral sclerosis-linked mutant SOD1-induced neuronal death via inhibition of PP2A-mediated dephosphorylation of Akt/PKB.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...