Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 9.84700455122948E-6

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 0.000

Synonym

Accession Q9BSF4 Q96EY6 Q96IT8
Symbols C19orf52

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG
Fruitfly EggNOG Inparanoid

AA Sequence

MAAAALRRFWSRRRAEAGDAVVAKPGVWARLGSWARALLRDYAEACRDASAEARARPGRAAVYVGLLGGA      1 - 70
AACFTLAPSEGAFEEALLEASGTLLLLAPATRNRESEAFVQRLLWLRGRGRLRYVNLGLCSLVYEAPFDA     71 - 140
QASLYQARCRYLQPRWTDFPGRVLDVGFVGRWWVLGAWMRDCDINDDEFLHLPAHLRVVGPQQLHSETNE    141 - 210
RLFDEKYKPVVLTDDQVDQALWEEQVLQKEKKDRLALSQAHSLVQAEAPR                        211 - 260
//

Text Mined References (6)

PMID Year Title
27718247 2016 TIM29 is a subunit of the human carrier translocase required for protein transport.
27554484 2016 Tim29 is a novel subunit of the human TIM22 translocase and is involved in complex assembly and stability.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.