Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 0.000

Synonym

Accession Q9BSF4 Q96EY6 Q96IT8
Symbols C19orf52

Gene

AA Sequence

MAAAALRRFWSRRRAEAGDAVVAKPGVWARLGSWARALLRDYAEACRDASAEARARPGRAAVYVGLLGGA      1 - 70
AACFTLAPSEGAFEEALLEASGTLLLLAPATRNRESEAFVQRLLWLRGRGRLRYVNLGLCSLVYEAPFDA     71 - 140
QASLYQARCRYLQPRWTDFPGRVLDVGFVGRWWVLGAWMRDCDINDDEFLHLPAHLRVVGPQQLHSETNE    141 - 210
RLFDEKYKPVVLTDDQVDQALWEEQVLQKEKKDRLALSQAHSLVQAEAPR                        211 - 260
//

Text Mined References (6)

PMID Year Title
27718247 2016 TIM29 is a subunit of the human carrier translocase required for protein transport.
27554484 2016 Tim29 is a novel subunit of the human TIM22 translocase and is involved in complex assembly and stability.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.