Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.19
PubTator Score 2.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease -1.052 4.1e-02
active ulcerative colitis -1.223 1.7e-02
astrocytic glioma 1.400 2.8e-02
atypical teratoid/rhabdoid tumor -1.300 9.4e-05
Breast cancer -1.800 1.6e-22
ductal carcinoma in situ -1.100 3.8e-02
ependymoma 1.500 7.0e-04
gastric cancer 1.200 1.7e-02
group 3 medulloblastoma -1.300 2.4e-03
hepatocellular carcinoma 1.200 1.0e-03
intraductal papillary-mucinous neoplasm ... 1.100 3.2e-02
invasive ductal carcinoma -1.048 1.1e-03
medulloblastoma, large-cell -1.100 2.7e-03
osteosarcoma -2.138 3.4e-03
ovarian cancer 1.600 3.0e-04
pancreatic cancer 1.600 4.6e-04
pancreatic carcinoma 1.600 4.6e-04
progressive supranuclear palsy -1.200 3.8e-02

AA Sequence

MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNTVILEYAHRLSQDIL      1 - 70
CDALQQWACNNIKYHDIPYIESEGP                                                  71 - 95
//

Text Mined References (14)

PMID Year Title