Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.19
PubTator Score 2.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Juvenile arthritis 124
Disease Target Count P-value
Breast cancer 3099 1.57531379816123E-22
posterior fossa group B ependymoma 1530 5.37375777036869E-8
ulcerative colitis 2087 7.04713512651378E-8
atypical teratoid/rhabdoid tumor 1095 9.37132758982522E-5
pancreatic carcinoma 567 5.04840009629662E-4
pancreatic cancer 2300 5.04840009629663E-4
group 3 medulloblastoma 2254 6.79736232165604E-4
hepatocellular carcinoma 550 0.0016094505059225
ovarian cancer 8492 0.00202295254140801
medulloblastoma, large-cell 6234 0.00266938748445215
invasive ductal carcinoma 2950 0.00329658487694656
osteosarcoma 7933 0.0033971002808821
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00693277222645913
gastric cancer 436 0.0174863893688838
astrocytic glioma 2241 0.0275717582666789
progressive supranuclear palsy 674 0.038360548423027
ductal carcinoma in situ 1745 0.0384325991328037
active Crohn's disease 918 0.0414676231046257
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Essential Hypertension 82 0.0 1.0
Disease Target Count Z-score Confidence
Loeys-Dietz syndrome 23 4.536 2.3
Ehlers-Danlos syndrome 42 3.946 2.0
Disease Target Count
Muscle Hypertrophy 2

Expression

  Differential Expression (18)

Synonym

Accession Q9BSF0 D3DPI3 P0C876 Q53TC7 Small membrane AKAP
Symbols smAKAP

Gene

PDB

5HVZ  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Pathway (1)

AA Sequence

MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNTVILEYAHRLSQDIL      1 - 70
CDALQQWACNNIKYHDIPYIESEGP                                                  71 - 95
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
23996002 2013 Cypher/ZASP is a novel A-kinase anchoring protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23115245 2012 A small novel A-kinase anchoring protein (AKAP) that localizes specifically protein kinase A-regulatory subunit I (PKA-RI) to the plasma membrane.
22344221 2012 Common variants at CDKAL1 and KLF9 are associated with body mass index in east Asian populations.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...