Property Summary

NCBI Gene PubMed Count 10
Grant Count 3
R01 Count 3
Funding $146,718.58
PubMed Score 2.19
PubTator Score 2.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Synonym

Accession Q9BSF0 D3DPI3 P0C876 Q53TC7 Small membrane AKAP
Symbols smAKAP

Gene

PDB

5HVZ  

AA Sequence

MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNTVILEYAHRLSQDIL      1 - 70
CDALQQWACNNIKYHDIPYIESEGP                                                  71 - 95
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
23996002 2013 Cypher/ZASP is a novel A-kinase anchoring protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23115245 2012 A small novel A-kinase anchoring protein (AKAP) that localizes specifically protein kinase A-regulatory subunit I (PKA-RI) to the plasma membrane.
22344221 2012 Common variants at CDKAL1 and KLF9 are associated with body mass index in east Asian populations.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...