Property Summary

NCBI Gene PubMed Count 18
Grant Count 3
Funding $200,163.47
PubMed Score 1.79
PubTator Score 19.03

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BSE5 Q5TDH1 Q9H5J3
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (10)

PMID Text
24663101 Depletion of the AGMAT expression upregulates HIV-1 CA A92E mutant infectivity in CsA-untreated HeLa cells and downregulates its infectivity in CsA-treated HeLa cells
23740519 Enzymes that are directly involved in the formation of urea are expressed in ocular tissues.
21803059 This study demonistrated that increased expression of agmatinase in hippocampal interneurons of subjects with mood disorders.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20808825 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20563878 Agmatinase activity was predominantly detected in neurons of rat and human brain.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16511187 X-ray crystallographic analysis of human agmatinase
14648699 Agmatinase is down-regulated in the clear cell type of renal cell carcinoma
11804860 an alternative to ornithine decarboxylase for polyamine biosynthesis

AA Sequence

MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEG      1 - 70
LDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRR     71 - 140
IQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHGAPFRRCVD    141 - 210
EGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDAL    211 - 280
DPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVT    281 - 350
TV                                                                        351 - 352
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23740519 2013 Enzymes of urea synthesis are expressed at the ocular surface, and decreased urea in the tear fluid is associated with dry-eye syndrome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21803059 2012 Agmatinase, an inactivator of the putative endogenous antidepressant agmatine, is strongly upregulated in hippocampal interneurons of subjects with mood disorders.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20808825 2010 Novel association strategy with copy number variation for identifying new risk Loci of human diseases.
20563878 2011 The agmatine-degrading enzyme agmatinase: a key to agmatine signaling in rat and human brain?
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...