Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.69
PubTator Score 19.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
acute quadriplegic myopathy -1.490 8.1e-05
astrocytic glioma -1.700 2.1e-02
atypical teratoid / rhabdoid tumor -1.700 5.5e-05
Barrett's esophagus 1.900 3.9e-02
cutaneous lupus erythematosus 1.900 8.6e-03
cystic fibrosis 1.219 4.5e-05
Duchenne muscular dystrophy -1.057 5.0e-05
ependymoma -2.100 2.4e-02
esophageal adenocarcinoma 2.500 1.8e-02
gastric carcinoma 2.500 5.0e-02
glioblastoma -1.100 5.1e-03
intraductal papillary-mucinous adenoma (... 1.400 3.1e-02
intraductal papillary-mucinous carcinoma... 2.800 4.8e-04
intraductal papillary-mucinous neoplasm ... 2.500 3.5e-03
limb girdle muscular dystrophy 2A -1.039 9.2e-05
lung cancer 2.900 1.3e-03
malignant mesothelioma 3.800 1.1e-08
medulloblastoma -1.600 3.4e-05
medulloblastoma, large-cell -1.700 2.2e-03
nephrosclerosis -2.220 2.3e-02
non-small cell lung cancer 1.009 1.1e-09
oligodendroglioma -1.900 1.9e-02
osteosarcoma -1.453 6.5e-04
ovarian cancer 1.700 3.5e-05
pancreatic ductal adenocarcinoma liver m... -2.527 1.8e-04
primitive neuroectodermal tumor -1.700 2.9e-04
tuberculosis 1.300 1.5e-03

Gene RIF (10)

AA Sequence

MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEG      1 - 70
LDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRR     71 - 140
IQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHGAPFRRCVD    141 - 210
EGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDAL    211 - 280
DPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVT    281 - 350
TV                                                                        351 - 352
//

Text Mined References (21)

PMID Year Title