Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Disease Target Count
Juvenile arthritis 126
Disease Target Count P-value
ovarian cancer 8520 4.8e-09
Pick disease 1894 1.3e-05
medulloblastoma, large-cell 6241 5.4e-04
osteosarcoma 7950 2.1e-03
aldosterone-producing adenoma 665 1.6e-02
spina bifida 1074 3.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Liver disease 237 0.0 3.0

Expression

  Differential Expression (6)

Disease log2 FC p
aldosterone-producing adenoma -1.104 1.6e-02
medulloblastoma, large-cell -1.500 5.4e-04
osteosarcoma -1.115 2.1e-03
ovarian cancer -1.500 4.8e-09
Pick disease 1.100 1.3e-05
spina bifida -1.208 3.8e-02

Gene RIF (1)

AA Sequence

MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLK      1 - 70
DILRKQDEYHMVHLVCTSRTPPSSPKSSTNRESHEALASSSNSSSDHSGSTTPSSGQETLSLAVGSSSEG     71 - 140
LRQRTLPQAQTDQAQSHQFPYVMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQMYAHQYYMQYQAAV    141 - 210
SAQATSNVNPTQPTTSQPLNLAHVPGEEPPPAPNLVAQENRPMNENVQMNAQGGPVLNEEDFNRDWLDWM    211 - 280
YTFSRAAILLSIVYFYSSFSRFIMVMGAMLLVYLHQAGWFPFRQEGGHQQAPNNNAEVNNDGQNANNLEL    281 - 350
EEMERLMDDGLEDESGEDGGEDASAIQRPGLMASAWSFITTFFTSLIPEGPPQVAN                  351 - 406
//

Text Mined References (11)

PMID Year Title