Property Summary

NCBI Gene PubMed Count 14
Grant Count 15
R01 Count 14
Funding $3,193,833
PubMed Score 91.10
PubTator Score 4.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.301 0.000
non-small cell lung cancer 1.682 0.000
interstitial cystitis -1.400 0.000
psoriasis 1.200 0.000
spina bifida -1.659 0.039
ductal carcinoma in situ 1.600 0.001
invasive ductal carcinoma 1.300 0.012
ovarian cancer 1.100 0.000

Gene RIF (2)

PMID Text
26237329 The study identified two proteins, TMEM79 and ACOXL, with potential to differentiate between benign and cancerous prostatic glands in tissue biopsies.
24084074 Tmem79/Matt is the matted mouse gene and is a predisposing gene for atopic dermatitis in human subjects.

AA Sequence

MTEQETLALLEVKRSDSPEKSSPQALVPNGRQPEGEGGAESPGAESLRVGSSAGSPTAIEGAEDGLDSTV      1 - 70
SEAATLPWGTGPQPSAPFPDPPGWRDIEPEPPESEPLTKLEELPEDDANLLPEKAARAFVPIDLQCIERQ     71 - 140
PQEDLIVRCEAGEGECRTFMPPRVTHPDPTERKWAEAVVRPPGCSCGGCGSCGDREWLRAVASVGAALIL    141 - 210
FPCLLYGAYAFLPFDVPRLPTMSSRLIYTLRCGVFATFPIVLGILVYGLSLLCFSALRPFGEPRREVEIH    211 - 280
RRYVAQSVQLFILYFFNLAVLSTYLPQDTLKLLPLLTGLFAVSRLIYWLTFAVGRSFRGFGYGLTFLPLL    281 - 350
SMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG                              351 - 394
//

Text Mined References (15)

PMID Year Title
26237329 2015 Analysis of the Human Prostate-Specific Proteome Defined by Transcriptomics and Antibody-Based Profiling Identifies TMEM79 and ACOXL as Two Putative, Diagnostic Markers in Prostate Cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25131691 2014 Mechanisms of abnormal lamellar body secretion and the dysfunctional skin barrier in patients with atopic dermatitis.
24647736 2014 Multiple nonglycemic genomic loci are newly associated with blood level of glycated hemoglobin in East Asians.
24084074 2013 Tmem79/Matt is the matted mouse gene and is a predisposing gene for atopic dermatitis in human subjects.
24060273 2013 A homozygous nonsense mutation in the gene for Tmem79, a component for the lamellar granule secretory system, produces spontaneous eczema in an experimental model of atopic dermatitis.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...