Property Summary

NCBI Gene PubMed Count 17
PubMed Score 98.87
PubTator Score 4.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ductal carcinoma in situ 1.600 6.6e-04
interstitial cystitis -1.400 1.3e-04
invasive ductal carcinoma 1.300 1.2e-02
non-small cell lung cancer 1.682 9.1e-15
osteosarcoma -1.301 2.8e-07
ovarian cancer 1.100 1.4e-06
psoriasis 1.100 2.7e-31
spina bifida -1.659 3.9e-02

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MTEQETLALLEVKRSDSPEKSSPQALVPNGRQPEGEGGAESPGAESLRVGSSAGSPTAIEGAEDGLDSTV      1 - 70
SEAATLPWGTGPQPSAPFPDPPGWRDIEPEPPESEPLTKLEELPEDDANLLPEKAARAFVPIDLQCIERQ     71 - 140
PQEDLIVRCEAGEGECRTFMPPRVTHPDPTERKWAEAVVRPPGCSCGGCGSCGDREWLRAVASVGAALIL    141 - 210
FPCLLYGAYAFLPFDVPRLPTMSSRLIYTLRCGVFATFPIVLGILVYGLSLLCFSALRPFGEPRREVEIH    211 - 280
RRYVAQSVQLFILYFFNLAVLSTYLPQDTLKLLPLLTGLFAVSRLIYWLTFAVGRSFRGFGYGLTFLPLL    281 - 350
SMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG                              351 - 394
//

Text Mined References (18)

PMID Year Title