Property Summary

NCBI Gene PubMed Count 7
PubMed Score 15.03
PubTator Score 93.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.200 0.006
ependymoma -1.400 0.019
osteosarcoma 1.320 0.000
tuberculosis 1.200 0.000
group 4 medulloblastoma -1.200 0.000
ovarian cancer 2.000 0.000

AA Sequence

MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPP      1 - 70
PGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTII     71 - 140
LGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK                        141 - 190
//

Text Mined References (11)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19519914 2009 On the cytotoxicity of HCR-NTPase in the neuroblastoma cell line SH-SY5Y.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17291528 2007 NMR structure and functional characterization of a human cancer-related nucleoside triphosphatase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...