Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1560.80
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.194 6.6e-04
atypical teratoid / rhabdoid tumor 1.200 2.6e-04
ependymoma 1.200 3.4e-07
glioblastoma 1.300 1.0e-06
group 3 medulloblastoma 1.900 1.6e-04
intraductal papillary-mucinous neoplasm ... 1.100 8.7e-03
invasive ductal carcinoma 1.100 5.0e-03
nasopharyngeal carcinoma 1.200 1.8e-03
non-small cell lung cancer 1.274 1.4e-16
osteosarcoma -1.219 5.0e-02
ovarian cancer 1.400 7.2e-05
pediatric high grade glioma 1.600 2.9e-06
primitive neuroectodermal tumor 1.700 5.2e-05

Synonym

Accession Q9BSD3 B7Z989
Symbols RHINO
C12orf32
HKMT1188

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MPPRKKRRQPSQKAPLLFHQQPLEGPKHSCASTQLPITHTRQVPSKPIDHSTITSWVSPDFDTAAGSLFP      1 - 70
AYQKHQNRARHSSRKPTTSKFPHLTFESPQSSSSETLGIPLIRECPSESEKDVSRRPLVPVLSPQSCGNM     71 - 140
SVQALQSLPYVFIPPDIQTPESSSVKEELIPQDQKENSLLSCTLHTGTPNSPEPGPVLVKDTPEDKYGIK    141 - 210
VTWRRRQHLLAYLRERGKLSRSQFLVKS                                              211 - 238
//

Text Mined References (15)

PMID Year Title