Property Summary

NCBI Gene PubMed Count 14
Grant Count 46
R01 Count 19
Funding $5,146,537.37
PubMed Score 1492.90
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
25602520 Knockdown of RHINO in human cells partially abrogated ATR-Chk1 kinase signaling following UV irradiation but did not impact the loading of Rad9-Hus1-Rad1 complex on chromatin or the association of Rad9-Hus1-Rad1 complex with TopBP1.
24562772 Germline variation in the RHINO gene is unlikely to influence inherited susceptibility to breast cancer.
21659603 We suggest that RHINO functions together with the 9-1-1 complex and TopBP1 to fully activate ATR (ataxia telangiectasia and Rad3-related.
20811708 Identified C12orf32 to be significantly up-regulated in the great majority of clinical breast cancer specimens.

AA Sequence

MPPRKKRRQPSQKAPLLFHQQPLEGPKHSCASTQLPITHTRQVPSKPIDHSTITSWVSPDFDTAAGSLFP      1 - 70
AYQKHQNRARHSSRKPTTSKFPHLTFESPQSSSSETLGIPLIRECPSESEKDVSRRPLVPVLSPQSCGNM     71 - 140
SVQALQSLPYVFIPPDIQTPESSSVKEELIPQDQKENSLLSCTLHTGTPNSPEPGPVLVKDTPEDKYGIK    141 - 210
VTWRRRQHLLAYLRERGKLSRSQFLVKS                                              211 - 238
//

Text Mined References (15)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25602520 2015 RHINO forms a stoichiometric complex with the 9-1-1 checkpoint clamp and mediates ATR-Chk1 signaling.
25416956 2014 A proteome-scale map of the human interactome network.
24562772 2014 Evaluation of the RHINO gene for breast cancer predisposition in Finnish breast cancer families.
21659603 2011 A DNA damage response screen identifies RHINO, a 9-1-1 and TopBP1 interacting protein required for ATR signaling.
20811708 2010 Involvement of C12orf32 overexpression in breast carcinogenesis.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...