Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.13
PubTator Score 3.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Lung Neoplasms 232 0.0 0.0
Disease Target Count P-value
ovarian cancer 8519 2.6e-06
psoriasis 6694 9.0e-04
Disease Target Count Z-score Confidence
Smith-Magenis syndrome 29 3.735 1.9
Spinocerebellar ataxia type 7 13 3.561 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.800 2.6e-06
psoriasis 1.200 9.0e-04

Synonym

Accession Q9BSB4 Q9HAE2 Q9HBN1
Symbols C12orf44

Gene

PDB

4WZG   5C50  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSE      1 - 70
ELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQIC     71 - 140
REKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRR    141 - 210
LIKDTLAL                                                                  211 - 218
//

Text Mined References (17)

PMID Year Title