Property Summary

NCBI Gene PubMed Count 10
Grant Count 3
R01 Count 3
Funding $116,593.74
PubMed Score 8.19
PubTator Score 3.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.200 0.001
ovarian cancer 1.800 0.000

Gene RIF (4)

PMID Text
26299944 Structure of the human Atg13-Atg101 HORMA heterodimer in the ULK1 complex that controls autophagy has been described.
23640897 Data indicate mitogen lacritin stimulates FOXO3-ATG101 and FOXO1-ATG7 autophagic coupling and restores metabolic homeostasis.
19597335 These data suggest that Atg101 is a novel Atg protein that functions together with ULK, Atg13 and FIP200.
19287211 The identification of the novel protein, Atg101, and the validation of Atg13 and Atg101 as ULK1-interacting proteins, suggests an Atg1 complex is involved in the induction of macroautophagy in mammalian cells.

AA Sequence

MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSE      1 - 70
ELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQIC     71 - 140
REKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRR    141 - 210
LIKDTLAL                                                                  211 - 218
//

Text Mined References (15)

PMID Year Title
26299944 2015 Structure of the Human Atg13-Atg101 HORMA Heterodimer: an Interaction Hub within the ULK1 Complex.
26236954 2015 The mammalian autophagy initiator complex contains 2 HORMA domain proteins.
23640897 2013 Lacritin rescues stressed epithelia via rapid forkhead box O3 (FOXO3)-associated autophagy that restores metabolism.
23392225 2013 FIP200 regulates targeting of Atg16L1 to the isolation membrane.
21269460 2011 Initial characterization of the human central proteome.
20562859 2010 Network organization of the human autophagy system.
19597335 2009 Atg101, a novel mammalian autophagy protein interacting with Atg13.
19287211 2009 A novel, human Atg13 binding protein, Atg101, interacts with ULK1 and is essential for macroautophagy.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16541075 2006 The finished DNA sequence of human chromosome 12.
More...