Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.90
PubTator Score 6.03

Knowledge Summary

Patent (1,623)

Expression

Synonym

Accession Q9BSA4 B3KX97 Q3B7H8 Q3B7R9 Q6AWB4 Q8NBB7 Q96PK1 hTTY2
Symbols C17orf29

Gene

Gene RIF (4)

PMID Text
18577513 Nedd4-2 differentially interacts with and regulates TTYH1-3
18260827 N-glycosylation is not the determining factor for TTYH2 trafficking to the plasma membrane.
17569141 TTYH2 gene expression is significantly up-regulated in colon cancer. The TTYH2 gene may play an important role in regulating both proliferating and metastatic potentials of colorectal cancer.
11597145 expressed most highly in brain and testis and at lower levels in heart, ovary, spleen, and peripheral blood leukocytes. Expression of this gene is upregulated in 13 of 16 (81%) renal cell carcinoma samples examined

AA Sequence

MQAARVDYIAPWWVVWLHSVPHVGLRLQPVNSTFSPGDESYQESLLFLGLVAAVCLGLNLIFLVAYLVCA      1 - 70
CHCRRDDAVQTKQHHSCCITWTAVVAGLICCAAVGVGFYGNSETNDGAYQLMYSLDDANHTFSGIDALVS     71 - 140
GTTQKMKVDLEQHLARLSEIFAARGDYLQTLKFIQQMAGSVVVQLSGLPVWREVTMELTKLSDQTGYVEY    141 - 210
YRWLSYLLLFILDLVICLIACLGLAKRSKCLLASMLCCGALSLLLSWASLAADGSAAVATSDFCVAPDTF    211 - 280
ILNVTEGQISTEVTRYYLYCSQSGSSPFQQTLTTFQRALTTMQIQVAGLLQFAVPLFSTAEEDLLAIQLL    281 - 350
LNSSESSLHQLTAMVDCRGLHKDYLDALAGICYDGLQGLLYLGLFSFLAALAFSTMICAGPRAWKHFTTR    351 - 420
NRDYDDIDDDDPFNPQAWRMAAHSPPRGQLHSFCSYSSGLGSQTSLQPPAQTISNAPVSEYMNQAMLFGR    421 - 490
NPRYENVPLIGRASPPPTYSPSMRATYLSVADEHLRHYGNQFPA                              491 - 534
//

Text Mined References (12)

PMID Year Title
18577513 2008 The ubiquitin-protein ligase Nedd4-2 differentially interacts with and regulates members of the Tweety family of chloride ion channels.
18260827 2008 N-glycosylation analysis of the human Tweety family of putative chloride ion channels supports a penta-spanning membrane arrangement: impact of N-glycosylation on cellular processing of Tweety homologue 2 (TTYH2).
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17569141 2007 TTYH2, a human homologue of the Drosophila melanogaster gene tweety, is up-regulated in colon carcinoma and involved in cell proliferation and cell aggregation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15010458 2004 A novel human Cl(-) channel family related to Drosophila flightless locus.
14739304 2004 A novel proteomic approach for specific identification of tyrosine kinase substrates using [13C]tyrosine.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...