Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.95
PubTator Score 4.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy -1.675 5.5e-04
adrenocortical adenoma 1.007 3.2e-02
astrocytic glioma -2.400 1.0e-02
atypical teratoid / rhabdoid tumor -1.100 5.1e-03
Breast cancer -1.200 4.0e-09
diabetes mellitus 1.200 4.3e-02
ductal carcinoma in situ -2.400 4.9e-04
glioblastoma -1.200 4.6e-04
hereditary spastic paraplegia -1.705 5.3e-03
invasive ductal carcinoma -2.500 4.0e-03
medulloblastoma, large-cell -1.200 1.5e-02
oligodendroglioma -2.400 1.4e-02
osteosarcoma -2.040 2.0e-05

Synonym

Accession Q9BS92 Q5VX30 Q9NUM2 NipSnap3B
Symbols FP944
SNAP1
NIPSNAP3

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MLVLRSGLTKALASRTLAPQVCSSFATGPRQYDGTFYEFRTYYLKPSNMNAFMENLKKNIHLRTSYSELV      1 - 70
GFWSVEFGGRTNKVFHIWKYDNFAHRAEVRKALANCKEWQEQSIIPNLARIDKQETEITYLIPWSKLEKP     71 - 140
PKEGVYELAVFQMKPGGPALWGDAFERAINAHVNLGYTKVVGVFHTEYGELNRVHVLWWNESADSRAAGR    141 - 210
HKSHEDPRVVAAVRESVNYLVSQQNMLLIPASFSPLK                                     211 - 247
//

Text Mined References (10)

PMID Year Title