Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.85
PubTator Score 4.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 3.95354467466207E-9
osteosarcoma 7933 2.03401469261274E-5
ductal carcinoma in situ 1745 3.45856500950279E-4
glioblastoma 5572 4.50011244416537E-4
acute quadriplegic myopathy 1157 5.53788413614108E-4
invasive ductal carcinoma 2950 9.67338819462618E-4
atypical teratoid / rhabdoid tumor 4369 0.00180648305908117
hereditary spastic paraplegia 313 0.00525716965020512
astrocytic glioma 2241 0.0112074295947024
oligodendroglioma 2849 0.0179219290250812
medulloblastoma, large-cell 6234 0.0211635256650683
adrenocortical adenoma 134 0.0315186230931926
diabetes mellitus 1663 0.0427616620707649
Disease Target Count Z-score Confidence
Tangier disease 8 3.224 1.6

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.500 0.011
oligodendroglioma -2.500 0.018
glioblastoma -1.500 0.000
osteosarcoma -2.040 0.000
atypical teratoid / rhabdoid tumor -1.200 0.002
medulloblastoma, large-cell -1.400 0.021
hereditary spastic paraplegia -1.705 0.005
acute quadriplegic myopathy -1.675 0.001
adrenocortical adenoma 1.007 0.032
diabetes mellitus 1.200 0.043
Breast cancer -1.200 0.000
ductal carcinoma in situ -2.700 0.000
invasive ductal carcinoma -3.500 0.001

Synonym

Accession Q9BS92 Q5VX30 Q9NUM2 NipSnap3B
Symbols FP944
SNAP1
NIPSNAP3

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Horse OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of nipsnap homolog 3B (NIPSNAP3B) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MLVLRSGLTKALASRTLAPQVCSSFATGPRQYDGTFYEFRTYYLKPSNMNAFMENLKKNIHLRTSYSELV      1 - 70
GFWSVEFGGRTNKVFHIWKYDNFAHRAEVRKALANCKEWQEQSIIPNLARIDKQETEITYLIPWSKLEKP     71 - 140
PKEGVYELAVFQMKPGGPALWGDAFERAINAHVNLGYTKVVGVFHTEYGELNRVHVLWWNESADSRAAGR    141 - 210
HKSHEDPRVVAAVRESVNYLVSQQNMLLIPASFSPLK                                     211 - 247
//

Text Mined References (10)

PMID Year Title
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15177564 2004 Expression pattern and raft association of NIPSNAP3 and NIPSNAP4, highly homologous proteins encoded by genes in close proximity to the ATP-binding cassette transporter A1.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11352567 2001 Human and mouse ABCA1 comparative sequencing and transgenesis studies revealing novel regulatory sequences.