Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.33
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
hepatocellular carcinoma 1.200 1.2e-04
juvenile dermatomyositis 1.000 3.0e-13
osteosarcoma -1.099 1.7e-02
ovarian cancer -2.500 7.9e-09
pituitary cancer 1.300 1.8e-06
psoriasis -1.500 2.9e-04
tuberculosis and treatment for 6 months -1.200 1.8e-02

AA Sequence

MEKQCCSHPVICSLSTMYTFLLGAIFIALSSSRILLVKYSANEENKYDYLPTTVNVCSELVKLVFCVLVS      1 - 70
FCVIKKDHQSRNLKYASWKEFSDFMKWSIPAFLYFLDNLIVFYVLSYLQPAMAVIFSNFSIITTALLFRI     71 - 140
VLKRRLNWIQWASLLTLFLSIVALTAGTKTLQHNLAGRGFHHDAFFSPSNSCLLFRSECPRKDNCTAKEW    141 - 210
TFPEAKWNTTARVFSHIRLGMGHVLIIVQCFISSMANIYNEKILKEGNQLTESIFIQNSKLYFFGILFNG    211 - 280
LTLGLQRSNRDQIKNCGFFYGHSAFSVALIFVTAFQGLSVAFILKFLDNMFHVLMAQVTTVIITTVSVLV    281 - 350
FDFRPSLEFFLEAPSVLLSIFIYNASKPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESD    351 - 420
EDTF                                                                      421 - 424
//

Text Mined References (13)

PMID Year Title