Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
Funding $359,866
PubMed Score 25.93
PubTator Score 1.52

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
21911476 Data suggest that missense mutations exert a dominant-negative effect due to altered ZPBP1 protein folding and protein:protein interactions in the acrosome.
17664285 Data show that loss of zona pellucida binding proteins 1 and 2 in the acrosomal matrix disrupts acrosome biogenesis and sperm morphogenesis.

AA Sequence

MEAFALGPARRGRRRTRAAGSLLSRAAILLFISAFLVRVPSSVGHLVRLPRAFRLTKDSVKIVGSTSFPV      1 - 70
KAYVMLHQKSPHVLCVTQQLRNAELIDPSFQWYGPKGKVVSVENRTAQITSTGSLVFQNFEESMSGIYTC     71 - 140
FLEYKPTVEEIVKRLQLKYAIYAYREPHYYYQFTARYHAAPCNSIYNISFEKKLLQILSKLLLDLSCEIS    141 - 210
LLKSECHRVKMQRAGLQNELFFAFSVSSLDTEKGPKRCTDHNCEPYKRLFKAKNLIERFFNQQVEILGRR    211 - 280
AEQLPQIYYIEGTLQMVWINRCFPGYGMNVQQHPKCPECCVICSPGSYNPRDGIHCLQCNSSLVYGAKTC    281 - 350
L//

Publication (14)

PMID Year Title
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21911476 2012 Association of mutations in the zona pellucida binding protein 1 (ZPBP1) gene with abnormal sperm head morphology in infertile men.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
17664285 2007 Loss of zona pellucida binding proteins in the acrosomal matrix disrupts acrosome biogenesis and sperm morphogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12883658 2003 Identification and characterization of human ZPBP-like gene in silico.
12853948 2003 The DNA sequence of human chromosome 7.
More...