Property Summary

NCBI Gene PubMed Count 16
Grant Count 35
R01 Count 10
Funding $13,050,359.4
PubMed Score 319.07
PubTator Score 612.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -7.400 0.000
osteosarcoma -1.804 0.002
posterior fossa group A ependymoma 1.800 0.000
glioblastoma 1.300 0.001
cystic fibrosis 2.102 0.000
medulloblastoma, large-cell -1.300 0.001
primary pancreatic ductal adenocarcinoma 2.490 0.000
colon cancer -1.300 0.001
lung cancer -1.200 0.001
pilocytic astrocytoma 1.700 0.000
invasive ductal carcinoma 1.135 0.006
nasopharyngeal carcinoma -1.200 0.003
lung adenocarcinoma -1.076 0.002
Polycystic Ovary Syndrome 2.014 0.042
lung carcinoma -1.800 0.000
Breast cancer -1.900 0.000
ovarian cancer -4.800 0.000
pancreatic cancer 2.300 0.000

Gene RIF (8)

PMID Text
26530530 Results show that Lxn expression was clearly decreased in the pancreatic ductal adenocarcinoma tissues suggesting it that as a tumor suppressor that targets CD133-positive cancer cells.
25551472 Lxn protein and mRNA expression levels in CD133+ miapaca-2 cells were significantly lower than those in CD133- cells.
24399246 latexin is markedly downregulated in hepatocellular carcinoma specimens, compared to adjacent non-cancerous tissues.
23712706 CD146 and Lxn increased tumor migration and invasion of thyroid cancer.
23364479 The hematopoietic stem cell regulatory gene latexin has tumor-suppressive properties in malignant melanoma.
23028717 These results are consistent with a tumor suppressor role for latexin.
21567403 Latexin expression is lost or greatly reduced in approximately 50% of human leukemia/lymphoma cell lines.
21466706 downregulated expression in gastric carcinomas; tumor suppressor

AA Sequence

MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEEIIQKQVKVNC      1 - 70
TAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLA     71 - 140
WVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVK    141 - 210
HNSRLPKEVQLE                                                              211 - 222
//

Text Mined References (19)

PMID Year Title
26530530 2016 Latexin exhibits tumor-suppressor potential in pancreatic ductal adenocarcinoma.
25551472 2014 Latexin inhibits the proliferation of CD133+ miapaca-2 pancreatic cancer stem-like cells.
25416956 2014 A proteome-scale map of the human interactome network.
24399246 2014 Latexin exhibits tumor suppressor potential in hepatocellular carcinoma.
23712706 2013 Clinical significance of CD146 and latexin during different stages of thyroid cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23364479 2013 The hematopoietic stem cell regulatory gene latexin has tumor-suppressive properties in malignant melanoma.
23028717 2012 Latexin is down-regulated in hematopoietic malignancies and restoration of expression inhibits lymphoma growth.
21567403 2012 Latexin regulates the abundance of multiple cellular proteins in hematopoietic stem cells.
21466706 2011 Latexin expression is downregulated in human gastric carcinomas and exhibits tumor suppressor potential.
More...