Property Summary

NCBI Gene PubMed Count 17
PubMed Score 344.39
PubTator Score 612.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Astrocytoma, Pilocytic 1.700 6.7e-05
Breast cancer -1.900 8.8e-08
colon cancer -1.300 7.8e-04
cystic fibrosis 2.102 9.6e-06
ependymoma 1.700 7.1e-07
glioblastoma 1.300 5.5e-04
invasive ductal carcinoma 1.135 6.3e-03
lung adenocarcinoma -1.076 2.1e-03
lung cancer -1.200 1.1e-03
lung carcinoma -1.800 7.9e-17
malignant mesothelioma -7.400 4.3e-10
medulloblastoma, large-cell -1.300 8.4e-04
nasopharyngeal carcinoma -1.200 3.5e-03
osteosarcoma -1.804 2.3e-03
ovarian cancer -4.800 5.0e-15
pancreatic cancer 2.300 4.1e-04
Polycystic ovary syndrome 2.014 4.2e-02
primary pancreatic ductal adenocarcinoma 2.490 3.7e-04

Gene RIF (9)

AA Sequence

MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEEIIQKQVKVNC      1 - 70
TAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLA     71 - 140
WVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVK    141 - 210
HNSRLPKEVQLE                                                              211 - 222
//

Text Mined References (20)

PMID Year Title