Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.23
PubTator Score 0.33

Knowledge Summary


No data available

AA Sequence

ALRSHERTHTGEKPYECKKCGKAFSCSSSLRKHERAYMW                                   351 - 389

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
19060904 2009 An empirical framework for binary interactome mapping.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).