Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.23
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.100 1.9e-03
Astrocytoma, Pilocytic 1.300 2.7e-05
atypical teratoid / rhabdoid tumor 1.600 9.7e-07
ependymoma 1.100 9.4e-10
glioblastoma 1.400 4.5e-07
group 3 medulloblastoma 1.900 1.3e-04
medulloblastoma, large-cell 2.000 5.5e-05
primitive neuroectodermal tumor 1.900 5.4e-05

AA Sequence

MDSVSFEDVAVAFTQEEWALLDPSQKNLYRDVMQEIFRNLASVGNKSEDQNIQDDFKNPGRNLSSHVVER      1 - 70
LFEIKEGSQYGETFSQDSNLNLNKKVSTGVKPCECSVCGKVFICHSALHRHILSHIGNKLFECEECPEKL     71 - 140
YHCKQCGKAFISLTSVDRHMVTHTSNGPYKGPVYEKPFDFPSVFQMPQSTYTGEKTYKCKHCDKAFNYSS    141 - 210
YLREHERTHTGEKPYACKKCGKSFTFSSSLRQHERSHTGEKPYECKECGKAFSRSTYLGIHERTHTGEKP    211 - 280
YECIKCGKAFRCSRVLRVHERTHSGEKPYECKQCGKAFKYSSNLCEHERTHTGVKPYGCKECGKSFTSSS    281 - 350
ALRSHERTHTGEKPYECKKCGKAFSCSSSLRKHERAYMW                                   351 - 389
//

Text Mined References (12)

PMID Year Title