Property Summary

NCBI Gene PubMed Count 28
PubMed Score 26.73
PubTator Score 29.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
malignant mesothelioma 3163 9.2447786448812E-9
ovarian cancer 8492 9.75736904055907E-7
psoriasis 6685 2.34030433818495E-5
osteosarcoma 7933 6.67196467460223E-5
glioblastoma 5572 1.07419016682744E-4
atypical teratoid / rhabdoid tumor 4369 2.43662298091078E-4
gastric cancer 436 9.61991259528654E-4
Multiple myeloma 1328 0.00206058044387288
astrocytoma 1493 0.00218063537481668
adult high grade glioma 2148 0.00224696103441583
subependymal giant cell astrocytoma 2287 0.00792147687607831
lung cancer 4473 0.00824971513023566
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0235460394926621

Expression

  Differential Expression (13)

Disease log2 FC p
gastric cancer 1.200 0.001
Multiple myeloma 1.292 0.002
malignant mesothelioma 2.700 0.000
psoriasis -2.300 0.000
osteosarcoma -1.601 0.000
astrocytoma 1.400 0.002
glioblastoma 1.800 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
pancreatic ductal adenocarcinoma liver m... -1.306 0.024
lung cancer -1.200 0.008
adult high grade glioma -1.200 0.002
subependymal giant cell astrocytoma 1.241 0.008
ovarian cancer 2.600 0.000

Synonym

Accession Q9BS26 O60319 Q4VXC1 Q5VWZ7 Q6UW14 Q8WX67 ER protein 44
Symbols PDIA10
TXNDC4

Gene

PDB

2R2J  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (15)

PMID Text
25512553 the decrease in 5-HT uptake rates of GDM trophoblast is the consequence of defective insulin signaling, which entraps SERT with ERp44 and impairs its glycosylation.
25097228 Endogenous ERp44 is O-glycosylated and secreted by human primary endometrial cells, suggesting possible pathophysiological roles of these processes.
24804790 findings indicated that overexpression of miR-101 could downregulate ERp44
23979138 Data indicate that protein disulfide isomerase (PDI) and ERp44 dynamically localize Ero1alpha and peroxiredoxin 4 in early secretory compartment (ESC).
23685074 The ERp44 assembly control cycle couples secretion fidelity and efficiency downstream of the calnexin/calreticulin and BiP-dependent quality control cycles.
22451649 ERp44 together with Ero1-Lalpha plays an important role in disulfide formation of SERT, which may be a prerequisite step for the assembly of SERT molecules in oligomeric form.
22190034 HIV-1 gp120 is identified to have a physical interaction with endoplasmic reticulum protein 44 (ERP44) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18552768 Crystal structure of ERp44 at a resolution of 2.6 A, is presented.
More...

AA Sequence

MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEE      1 - 70
ASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQK     71 - 140
SDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNII    141 - 210
YKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQ    211 - 280
NEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFD    281 - 350
LHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL                  351 - 406
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25512553 2014 GDM-associated insulin deficiency hinders the dissociation of SERT from ERp44 and down-regulates placental 5-HT uptake.
25097228 2014 Progressive quality control of secretory proteins in the early secretory compartment by ERp44.
24804790 2014 MiR-101 regulates apoptosis of trophoblast HTR-8/SVneo cells by targeting endoplasmic reticulum (ER) protein 44 during preeclampsia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979138 2013 Dynamic regulation of Ero1? and peroxiredoxin 4 localization in the secretory pathway.
23685074 2013 A pH-regulated quality control cycle for surveillance of secretory protein assembly.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
22451649 2012 The role of ERp44 in maturation of serotonin transporter protein.
21269460 2011 Initial characterization of the human central proteome.
More...