Property Summary

NCBI Gene PubMed Count 30
PubMed Score 27.97
PubTator Score 29.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.200 2.2e-03
astrocytoma 1.400 2.2e-03
Astrocytoma, Pilocytic -1.100 5.0e-04
atypical teratoid / rhabdoid tumor -1.600 2.4e-04
gastric cancer 1.200 9.6e-04
glioblastoma 1.800 1.1e-04
lung cancer -1.200 8.2e-03
malignant mesothelioma 1.600 4.2e-07
Multiple myeloma 1.292 2.1e-03
osteosarcoma -1.074 4.6e-05
ovarian cancer -1.100 8.3e-06
pancreatic ductal adenocarcinoma liver m... -1.306 2.4e-02
psoriasis -2.300 2.3e-05
subependymal giant cell astrocytoma 1.241 7.9e-03

 GWAS Trait (1)

Gene RIF (16)

AA Sequence

MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEE      1 - 70
ASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQK     71 - 140
SDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNII    141 - 210
YKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQ    211 - 280
NEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFD    281 - 350
LHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL                  351 - 406
//

Text Mined References (34)

PMID Year Title