Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.23
PubTator Score 2.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.4e-07
malignant mesothelioma 3232 2.1e-05
Multiple myeloma 1332 9.2e-03
Breast cancer 3578 4.7e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 2.100 4.7e-02
malignant mesothelioma 1.600 2.1e-05
Multiple myeloma 1.081 9.2e-03
ovarian cancer -1.800 1.4e-07

Synonym

Accession Q9BS18 Q9Y3V0 APC13
Symbols SWM1
APC13

Gene

PDB

4UI9   5G04   5KHR   5KHU   5L9T   5L9U   5LCW  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVP      1 - 70
PIGN                                                                       71 - 74
//

Text Mined References (15)

PMID Year Title